Recombinant Human GMCL1 Protein, GST-tagged
Cat.No. : | GMCL1-5003H |
Product Overview : | Human GMCL1 full-length ORF ( NP_848526.1, 1 a.a. - 515 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a nuclear envelope protein that appears to be involved in spermatogenesis, either directly or by influencing genes that play a more direct role in the process. This multi-exon locus is the homolog of the mouse and drosophila germ cell-less gene but the human genome also contains a single-exon locus on chromosome 5 that contains an open reading frame capable of encoding a highly-related protein. [provided by RefSeq |
Molecular Mass : | 85.1 kDa |
AA Sequence : | MGSLSSRVLRQPRPALAQQAQGARAGGSARRPDTGDDAAGHGFCYCAGSHKRKRSSGSFCYCHPDSETDEDEEEGDEQQRLLNTPRRKKLKSTSKYIYQTLFLNGENSDIKICALGEEWSLHKIYLCQSGYFSSMFSGSWKESSMNIIELEIPDQNIDVEALQVAFGSLYRDDVLIKPSRVVAILAAACLLQLDGLIQQCGETMKETVNVKTVCGYYTSAGTYGLDSVKKKCLEWLLNNLMTHQNVELFKELSINVMKQLIGSSNLFVMQVEMDIYTALKKWMFLQLVPSWNGSLKQLLTETDVWFSKQRKDFEGMAFLETEQGKPFVSVFRHLRLQYIISDLASARIIEQDAVVPSEWLSSVYKQQWFAMLRAEQDSEVGPQEINKEELEGNSMRCGRKLAKDGEYCWRWTGFNFGFDLLVTYTNRYIIFKRNTLNQPCSGSVSLQPRRSIAFRLRLASFDSSGKLICSRTTGYQILTLEKDQEQVVMNLDSRLLIFPLYICCNFLYISPEKKN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GMCL1 germ cell-less, spermatogenesis associated 1 [ Homo sapiens ] |
Official Symbol | GMCL1 |
Synonyms | GCL; GCL1; BTBD13; GMCL1; germ cell-less, spermatogenesis associated 1 |
Gene ID | 64395 |
mRNA Refseq | NM_178439 |
Protein Refseq | NP_848526 |
UniProt ID | Q96IK5 |
◆ Recombinant Proteins | ||
GMCL1-5367HF | Recombinant Full Length Human GMCL1 Protein, GST-tagged | +Inquiry |
GMCL1-3744M | Recombinant Mouse GMCL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GMCL1-5003H | Recombinant Human GMCL1 Protein, GST-tagged | +Inquiry |
GMCL1-6996M | Recombinant Mouse GMCL1 Protein | +Inquiry |
GMCL1-11783Z | Recombinant Zebrafish GMCL1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GMCL1 Products
Required fields are marked with *
My Review for All GMCL1 Products
Required fields are marked with *