Recombinant Human GMFB protein, GST-tagged
| Cat.No. : | GMFB-13333H |
| Product Overview : | Recombinant Human GMFB protein(1-154 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | September 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-154 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFTNVNFCVSKVFMY |
| Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | GMFB glia maturation factor, beta [ Homo sapiens ] |
| Official Symbol | GMFB |
| Synonyms | GMFB; glia maturation factor, beta; glia maturation factor beta; GMF; GMF-beta; |
| Gene ID | 2764 |
| mRNA Refseq | NM_004124 |
| Protein Refseq | NP_004115 |
| MIM | 601713 |
| UniProt ID | P60983 |
| ◆ Recombinant Proteins | ||
| GMFB-12333Z | Recombinant Zebrafish GMFB | +Inquiry |
| GMFB-5010H | Recombinant Human GMFB Protein, GST-tagged | +Inquiry |
| GMFB-2240R | Recombinant Rat GMFB Protein, His (Fc)-Avi-tagged | +Inquiry |
| GMFB-3247H | Recombinant Human GMFB Protein (Met1-His142), C-His tagged | +Inquiry |
| GMFB-2877C | Recombinant Chicken GMFB | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GMFB-5883HCL | Recombinant Human GMFB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GMFB Products
Required fields are marked with *
My Review for All GMFB Products
Required fields are marked with *
