Recombinant Human GMFB Protein, GST-tagged GMFB-5010H

Cat.No.:	GMFB-5010H
Product Overview:	Human GMFB full-length ORF ( AAH05359, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.
Description:	GMFB (Glia Maturation Factor Beta) is a Protein Coding gene. Among its related pathways are Development Angiotensin activation of ERK and Signal transduction_Erk Interactions- Inhibition of Erk. GO annotations related to this gene include actin binding and growth factor activity. An important paralog of this gene is GMFG.
Source:	Wheat Germ
Species:	Human
Tag :	GST
Molecular Mass:	42.68 kDa
AA Sequence:	MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFTNVNFCVSKVFMY
Applications:	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes:	Best use within three months from the date of receipt of this protein.
Storage:	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Download Datasheet

Gene Name:	GMFB glia maturation factor, beta [ Homo sapiens ]
Official Symbol:	GMFB
Synonyms:	GMFB; glia maturation factor, beta; glia maturation factor beta; GMF; GMF-beta;
Gene ID:	2764
mRNA Refseq:	NM_004124
Protein Refseq:	NP_004115
MIM:	601713
UniProt ID:	P60983