| Cat.No.: | GMFB-5010H |
| Product Overview: | Human GMFB full-length ORF ( AAH05359, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal. |
| Description: | GMFB (Glia Maturation Factor Beta) is a Protein Coding gene. Among its related pathways are Development Angiotensin activation of ERK and Signal transduction_Erk Interactions- Inhibition of Erk. GO annotations related to this gene include actin binding and growth factor activity. An important paralog of this gene is GMFG. |
| Source: | Wheat Germ |
| Species: | Human |
| Tag : | GST |
| Molecular Mass: | 42.68 kDa |
| AA Sequence: | MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFTNVNFCVSKVFMY |
| Applications: | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes: | Best use within three months from the date of receipt of this protein. |
| Storage: | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name: | GMFB glia maturation factor, beta [ Homo sapiens ] |
| Official Symbol: | GMFB |
| Synonyms: | GMFB; glia maturation factor, beta; glia maturation factor beta; GMF; GMF-beta; |
| Gene ID: | 2764 |
| mRNA Refseq: | NM_004124 |
| Protein Refseq: | NP_004115 |
| MIM: | 601713 |
| UniProt ID: | P60983 |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All GMFB Products
Download Datasheet