Recombinant Human GML Protein, GST-tagged
| Cat.No. : | GML-5013H |
| Product Overview : | Human GML partial ORF ( NP_002057, 48 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | GML (Glycosylphosphatidylinositol Anchored Molecule Like) is a Protein Coding gene. Diseases associated with GML include Ainhum and Factor X Deficiency. |
| Molecular Mass : | 37.95 kDa |
| AA Sequence : | CPYHIRRCMTISIRINSRELLVYKNCTNNCTFVYAAEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTNLERDMLPDEVTEEELPEGTVRLGVSKLLLSFASIIVSNILP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GML glycosylphosphatidylinositol anchored molecule like protein [ Homo sapiens ] |
| Official Symbol | GML |
| Synonyms | GML; glycosylphosphatidylinositol anchored molecule like protein; GPI anchored molecule like protein; glycosyl-phosphatidylinositol-anchored molecule-like protein; LY6DL; Glycosylphosphatidylinositol-anchored molecule-like protein; |
| Gene ID | 2765 |
| mRNA Refseq | NM_002066 |
| Protein Refseq | NP_002057 |
| MIM | 602370 |
| UniProt ID | Q99445 |
| ◆ Recombinant Proteins | ||
| GML-578H | Recombinant Human GML Protein, His/GST-tagged | +Inquiry |
| GML-13335H | Recombinant Human GML, GST-tagged | +Inquiry |
| GML-5013H | Recombinant Human GML Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GML-5881HCL | Recombinant Human GML 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GML Products
Required fields are marked with *
My Review for All GML Products
Required fields are marked with *
