"GML" Related Products

Recombinant Human GML Protein, GST-tagged

Cat.No.: GML-5013H
Product Overview: Human GML partial ORF ( NP_002057, 48 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.
Description: GML (Glycosylphosphatidylinositol Anchored Molecule Like) is a Protein Coding gene. Diseases associated with GML include Ainhum and Factor X Deficiency.
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 37.95 kDa
AA Sequence: CPYHIRRCMTISIRINSRELLVYKNCTNNCTFVYAAEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTNLERDMLPDEVTEEELPEGTVRLGVSKLLLSFASIIVSNILP
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: GML glycosylphosphatidylinositol anchored molecule like protein [ Homo sapiens ]
Official Symbol: GML
Synonyms: GML; glycosylphosphatidylinositol anchored molecule like protein; GPI anchored molecule like protein; glycosyl-phosphatidylinositol-anchored molecule-like protein; LY6DL; Glycosylphosphatidylinositol-anchored molecule-like protein;
Gene ID: 2765
mRNA Refseq: NM_002066
Protein Refseq: NP_002057
MIM: 602370
UniProt ID: Q99445

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.