Recombinant Human GML Protein, GST-tagged

Cat.No. : GML-5013H
Product Overview : Human GML partial ORF ( NP_002057, 48 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GML (Glycosylphosphatidylinositol Anchored Molecule Like) is a Protein Coding gene. Diseases associated with GML include Ainhum and Factor X Deficiency.
Molecular Mass : 37.95 kDa
AA Sequence : CPYHIRRCMTISIRINSRELLVYKNCTNNCTFVYAAEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTNLERDMLPDEVTEEELPEGTVRLGVSKLLLSFASIIVSNILP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GML glycosylphosphatidylinositol anchored molecule like protein [ Homo sapiens ]
Official Symbol GML
Synonyms GML; glycosylphosphatidylinositol anchored molecule like protein; GPI anchored molecule like protein; glycosyl-phosphatidylinositol-anchored molecule-like protein; LY6DL; Glycosylphosphatidylinositol-anchored molecule-like protein;
Gene ID 2765
mRNA Refseq NM_002066
Protein Refseq NP_002057
MIM 602370
UniProt ID Q99445

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GML Products

Required fields are marked with *

My Review for All GML Products

Required fields are marked with *

0
cart-icon
0
compare icon