Recombinant Human GMPR2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : GMPR2-956H
Product Overview : GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002000) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). The protein also functions in the re-utilization of free intracellular bases and purine nucleosides. Alternative splicing results in multiple transcript variants.
Molecular Mass : 37.9 kDa
AA Sequence : MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEACTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GMPR2 guanosine monophosphate reductase 2 [ Homo sapiens (human) ]
Official Symbol GMPR2
Synonyms GMPR2; guanosine monophosphate reductase 2; GMP reductase 2; guanosine monophosphate reductase isolog; guanosine 5-monophosphate oxidoreductase 2; MGC830; MGC15084;
Gene ID 51292
mRNA Refseq NM_001002000
Protein Refseq NP_001002000
MIM 610781
UniProt ID Q9P2T1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GMPR2 Products

Required fields are marked with *

My Review for All GMPR2 Products

Required fields are marked with *

0
cart-icon
0
compare icon