Recombinant Human GNA14 protein, GST-tagged
| Cat.No. : | GNA14-13344H |
| Product Overview : | Recombinant Human GNA14 protein(1-355 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 01, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-355 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSMLSREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLREFNLV |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | GNA14 guanine nucleotide binding protein (G protein), alpha 14 [ Homo sapiens ] |
| Official Symbol | GNA14 |
| Synonyms | GNA14; guanine nucleotide binding protein (G protein), alpha 14; guanine nucleotide-binding protein subunit alpha-14; g alpha-14; G-protein subunit alpha-14; guanine nucleotide-binding protein 14; |
| Gene ID | 9630 |
| mRNA Refseq | NM_004297 |
| Protein Refseq | NP_004288 |
| MIM | 604397 |
| UniProt ID | O95837 |
| ◆ Recombinant Proteins | ||
| GNA14-188H | Recombinant Human GNA14 protein, GST-tagged | +Inquiry |
| GNA14-3754M | Recombinant Mouse GNA14 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GNA14-1710R | Recombinant Rhesus Macaque GNA14 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GNA14-13344H | Recombinant Human GNA14 protein, GST-tagged | +Inquiry |
| GNA14-1090Z | Recombinant Zebrafish GNA14 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GNA14-721HCL | Recombinant Human GNA14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNA14 Products
Required fields are marked with *
My Review for All GNA14 Products
Required fields are marked with *
