Recombinant Human GNB2L1 protein, His-tagged
Cat.No. : | GNB2L1-2655H |
Product Overview : | Recombinant Human GNB2L1 protein(131-317 aa), fused to His tag, was expressed in E. coli. |
Availability | August 24, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 131-317 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTIGTR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GNB2L1 guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1 [ Homo sapiens ] |
Official Symbol | GNB2L1 |
Synonyms | GNB2L1; guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1; guanine nucleotide-binding protein subunit beta-2-like 1; Gnb2 rs1; H12.3; RACK1; Receptor for Activated C Kinase 1; lung cancer oncogene 7; proliferation-inducing gene 21; human lung cancer oncogene 7 protein; receptor of activated protein kinase C 1; cell proliferation-inducing gene 21 protein; guanine nucleotide-binding protein subunit beta-like protein 12.3; protein homologous to chicken B complex protein, guanine nucleotide binding; HLC-7; PIG21; Gnb2-rs1; |
Gene ID | 10399 |
mRNA Refseq | NM_006098 |
Protein Refseq | NP_006089 |
MIM | 176981 |
UniProt ID | P63244 |
◆ Recombinant Proteins | ||
GNB2L1-7028M | Recombinant Mouse GNB2L1 Protein | +Inquiry |
GNB2L1-465H | Recombinant Human GNB2L1 protein, His&MBP-tagged | +Inquiry |
GNB2L1-3767M | Recombinant Mouse GNB2L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNB2L1-2655H | Recombinant Human GNB2L1 protein, His-tagged | +Inquiry |
GNB2L1-30327TH | Recombinant Human GNB2L1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNB2L1-5862HCL | Recombinant Human GNB2L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNB2L1 Products
Required fields are marked with *
My Review for All GNB2L1 Products
Required fields are marked with *