Recombinant Human GNB2L1 protein, His-tagged

Cat.No. : GNB2L1-2655H
Product Overview : Recombinant Human GNB2L1 protein(131-317 aa), fused to His tag, was expressed in E. coli.
Availability May 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 131-317 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : LWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTIGTR
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name GNB2L1 guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1 [ Homo sapiens ]
Official Symbol GNB2L1
Synonyms GNB2L1; guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1; guanine nucleotide-binding protein subunit beta-2-like 1; Gnb2 rs1; H12.3; RACK1; Receptor for Activated C Kinase 1; lung cancer oncogene 7; proliferation-inducing gene 21; human lung cancer oncogene 7 protein; receptor of activated protein kinase C 1; cell proliferation-inducing gene 21 protein; guanine nucleotide-binding protein subunit beta-like protein 12.3; protein homologous to chicken B complex protein, guanine nucleotide binding; HLC-7; PIG21; Gnb2-rs1;
Gene ID 10399
mRNA Refseq NM_006098
Protein Refseq NP_006089
MIM 176981
UniProt ID P63244

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GNB2L1 Products

Required fields are marked with *

My Review for All GNB2L1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon