Recombinant Human GNB2L1 protein, His-tagged
| Cat.No. : | GNB2L1-2655H |
| Product Overview : | Recombinant Human GNB2L1 protein(131-317 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 19, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 131-317 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTIGTR |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | GNB2L1 guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1 [ Homo sapiens ] |
| Official Symbol | GNB2L1 |
| Synonyms | GNB2L1; guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1; guanine nucleotide-binding protein subunit beta-2-like 1; Gnb2 rs1; H12.3; RACK1; Receptor for Activated C Kinase 1; lung cancer oncogene 7; proliferation-inducing gene 21; human lung cancer oncogene 7 protein; receptor of activated protein kinase C 1; cell proliferation-inducing gene 21 protein; guanine nucleotide-binding protein subunit beta-like protein 12.3; protein homologous to chicken B complex protein, guanine nucleotide binding; HLC-7; PIG21; Gnb2-rs1; |
| Gene ID | 10399 |
| mRNA Refseq | NM_006098 |
| Protein Refseq | NP_006089 |
| MIM | 176981 |
| UniProt ID | P63244 |
| ◆ Recombinant Proteins | ||
| GNB2L1-9012Z | Recombinant Zebrafish GNB2L1 | +Inquiry |
| GNB2L1-2655H | Recombinant Human GNB2L1 protein, His-tagged | +Inquiry |
| GNB2L1-465H | Recombinant Human GNB2L1 protein, His&MBP-tagged | +Inquiry |
| GNB2L1-1375H | Recombinant Human Guanine Nucleotide-Binding Protein Subunit Beta-2-Like 1, His-tagged | +Inquiry |
| GNB2L1-7028M | Recombinant Mouse GNB2L1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GNB2L1-5862HCL | Recombinant Human GNB2L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNB2L1 Products
Required fields are marked with *
My Review for All GNB2L1 Products
Required fields are marked with *
