Recombinant Human GNB3 Protein, GST-tagged
Cat.No. : | GNB3-5056H |
Product Overview : | Human GNB3 full-length ORF ( AAH02454, 1 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. A single-nucleotide polymorphism (C825T) in this gene is associated with essential hypertension and obesity. This polymorphism is also associated with the occurrence of the splice variant GNB3-s, which appears to have increased activity. GNB3-s is an example of alternative splicing caused by a nucleotide change outside of the splice donor and acceptor sites. Additional splice variants may exist for this gene, but they have not been fully described. [provided by RefSeq |
Molecular Mass : | 63.14 kDa |
AA Sequence : | MGEMEQLRQEAEQLKKQIADARKACAGVTLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHESIICSITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERVGILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNB3 guanine nucleotide binding protein (G protein), beta polypeptide 3 [ Homo sapiens ] |
Official Symbol | GNB3 |
Synonyms | GNB3; guanine nucleotide binding protein (G protein), beta polypeptide 3; guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3; transducin beta chain 3; G protein, beta-3 subunit; hypertension associated protein; GTP-binding regulatory protein beta-3 chain; guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 3; |
Gene ID | 2784 |
mRNA Refseq | NM_002075 |
Protein Refseq | NP_002066 |
MIM | 139130 |
UniProt ID | P16520 |
◆ Recombinant Proteins | ||
GNB3-1718R | Recombinant Rhesus Macaque GNB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNB3-2257R | Recombinant Rat GNB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNB3-299H | Recombinant Human guanine nucleotide binding protein (G protein), beta polypeptide 3, His-tagged | +Inquiry |
GNB3-2602R | Recombinant Rat GNB3 Protein | +Inquiry |
GNB3-5056H | Recombinant Human GNB3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNB3-5861HCL | Recombinant Human GNB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNB3 Products
Required fields are marked with *
My Review for All GNB3 Products
Required fields are marked with *
0
Inquiry Basket