Recombinant Human GNB4 Protein, GST-tagged

• Cat.No.: GNB4-5057H
• Product Overview: Human GNB4 full-length ORF ( AAH00873.1, 1 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. [provided by RefSeq
• Molecular Mass: 63.14 kDa
• AA Sequence: MSELEQLRQEAEQLRNQIQDAREACNDATLVQITSNMDSVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELPGHTGYLSCCRFLDDSQIVTSSGDTTCALWDIETAQQTTTFTGHSGDVMSLSLSPDMRTFVSGACDASSKLWDIRDGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTLKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GNB4 guanine nucleotide binding protein (G protein), beta polypeptide 4 [ Homo sapiens ]
• Official Symbol: GNB4
• Synonyms: GNB4; guanine nucleotide binding protein (G protein), beta polypeptide 4; guanine nucleotide-binding protein subunit beta-4; transducin beta chain 4; G protein beta-4 subunit; guanine nucleotide binding protein beta subunit 4
• Gene ID: 59345
• mRNA Refseq: NM_021629
• Protein Refseq: NP_067642
• MIM: 610863
• UniProt ID: Q9HAV0