Recombinant Full Length Human GNB4 Protein, GST-tagged
Cat.No. : | GNB4-5371HF |
Product Overview : | Human GNB4 full-length ORF ( AAH00873.1, 1 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 340 amino acids |
Description : | Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. [provided by RefSeq |
Molecular Mass : | 63.14 kDa |
AA Sequence : | MSELEQLRQEAEQLRNQIQDAREACNDATLVQITSNMDSVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELPGHTGYLSCCRFLDDSQIVTSSGDTTCALWDIETAQQTTTFTGHSGDVMSLSLSPDMRTFVSGACDASSKLWDIRDGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTLKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNB4 guanine nucleotide binding protein (G protein), beta polypeptide 4 [ Homo sapiens ] |
Official Symbol | GNB4 |
Synonyms | GNB4; guanine nucleotide binding protein (G protein), beta polypeptide 4; guanine nucleotide-binding protein subunit beta-4; transducin beta chain 4; G protein beta-4 subunit; guanine nucleotide binding protein beta subunit 4; |
Gene ID | 59345 |
mRNA Refseq | NM_021629 |
Protein Refseq | NP_067642 |
MIM | 610863 |
UniProt ID | Q9HAV0 |
◆ Recombinant Proteins | ||
GNB4-1719R | Recombinant Rhesus Macaque GNB4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNB4-5057H | Recombinant Human GNB4 Protein, GST-tagged | +Inquiry |
GNB4-2258R | Recombinant Rat GNB4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNB4-7030M | Recombinant Mouse GNB4 Protein | +Inquiry |
GNB4-3768M | Recombinant Mouse GNB4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNB4-5860HCL | Recombinant Human GNB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNB4 Products
Required fields are marked with *
My Review for All GNB4 Products
Required fields are marked with *