Recombinant Human GNE, His-tagged
Cat.No. : | GNE-94H |
Product Overview : | Recombinant Human Bifunctional UDP-N-Acetylglucosamine 2-Epimerase/N-Acetylmannosamine Kinase/GNE is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Tyr722) of Human GNE fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | Bifunctional UDP-N-Acetylglucosamine 2-Epimerase/N-Acetylmannosamine Kinase (GNE) contains two regions: UDP-N-acetylglucosamine 2-epimerase that belongs to the UDP-N-acetylglucosamine 2-epimerase family and N-acetylmannosamine kinase that belongs to the ROK (NagC/XylR) family. GNE localizes to the cytoplasm and exists as a homodimer and homohexamer. GNE is widely expressed, with the highest levels observed in the liver and placenta. GNE regulates and initiates biosynthesis of N-acetylneuraminic acid (NeuAc), a precursor of sialic acids. It is required for normal sialylation in hematopoietic cells. Sialylation is implicated in cell adhesion, signal transduction, tumorigenicity, and metastatic behavior of malignant cells. In addition, GNE plays an essential role in early development. |
AA Sequence : | MEKNGNNRKLRVCVATCNRADYSKLAPIMFGIKTEPEFFELDVVVLGSHLIDDYGNTYRMIEQDD FDINTRLHTIVRGEDEAAMVESVGLALVKLPDVLNRLKPDIMIVHGDRFDALALATSAALMNIRI LHIEGGEVSGTIDDSIRHAITKLAHYHVCCTRSAEQHLISMCEDHDRILLAGCPSYDKLLSAKNK DYMSIIRMWLGDDVKSKDYIVALQHPVTTDIKHSIKMFELTLDALISFNKRTLVLFPNIDAGSKE MVRVMRKKGIEHHPNFRAVKHVPFDQFIQLVAHAGCMIGNSSCGVREVGAFGTPVINLGTRQIGR ETGENVLHVRDADTQDKILQALHLQFGKQYPCSKIYGDGNAVPRILKFLKSIDLQEPLQKKFCFP PVKENISQDIDHILETLSALAVDLGGTNLRVAIVSMKGEIVKKYTQFNPKTYEERINLILQMCVE AAAEAVKLNCRILGVGISTGGRVNPREGIVLHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNC AALAERKFGQGKGLENFVTLITGTGIGGGIIHQHELIHGSSFCAAELGHLVVSLDGPDCSCGSHG CIEAYASGMALQREAKKLHDEDLLLVEGMSVPKDEAVGALHLIQAAKLGNAKAQSILRTAGTALG LGVVNILHTMNPSLVILSGVLASHYIHIVKDVIRQQALSSVQDVDVVVSDLVDPALLGAASMVLD YTTRRIYVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | GNE glucosamine (UDP-N-acetyl)-2-epimerase/N-acetylmannosamine kinase [ Homo sapiens ] |
Official Symbol | GNE |
Synonyms | GNE; glucosamine (UDP-N-acetyl)-2-epimerase/N-acetylmannosamine kinase; IBM2, UDP N acetylglucosamine 2 epimerase/N acetylmannosamine kinase; bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; Uae1; N-acylmannosamine kinase; UDP-GlcNAc-2-epimerase/ManAc kinase; UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; UDP-N-acetylglucosamine-2-epimerase/N-acetylmannosamine kinase; NM; DMRV; IBM2; GLCNE; |
Gene ID | 10020 |
mRNA Refseq | NM_001128227 |
Protein Refseq | NP_001121699 |
MIM | 603824 |
UniProt ID | Q9Y223 |
Chromosome Location | 9p13.1 |
Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; CMP-N-acetylneuraminate biosynthesis I (eukaryotes), organism-specific biosystem; Metabolic pathways, organism-specific biosystem; |
Function | ATP binding; N-acylmannosamine kinase activity; UDP-N-acetylglucosamine 2-epimerase activity; isomerase activity; kinase activity; nucleotide binding; transferase activity; |
◆ Recombinant Proteins | ||
GNE-6082H | Recombinant Human GNE Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GNE-94H | Recombinant Human GNE, His-tagged | +Inquiry |
GNE-13359H | Recombinant Human GNE, His-tagged | +Inquiry |
GNE-11130Z | Recombinant Zebrafish GNE | +Inquiry |
GNE-2605R | Recombinant Rat GNE Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNE-5858HCL | Recombinant Human GNE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNE Products
Required fields are marked with *
My Review for All GNE Products
Required fields are marked with *