Recombinant Human GNG11 Protein, GST-tagged
Cat.No. : | GNG11-5064H |
Product Overview : | Human GNG11 full-length ORF ( AAH09709, 1 a.a. - 73 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the guanine nucleotide-binding protein (G protein) gamma family and encodes a lipid-anchored, cell membrane protein. As a member of the heterotrimeric G protein complex, this protein plays a role in this transmembrane signaling system. This protein is also subject to carboxyl-terminal processing. Decreased expression of this gene is associated with splenic marginal zone lymphomas. [provided by RefSeq |
Molecular Mass : | 33.77 kDa |
AA Sequence : | MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNG11 guanine nucleotide binding protein (G protein), gamma 11 [ Homo sapiens ] |
Official Symbol | GNG11 |
Synonyms | GNG11; guanine nucleotide binding protein (G protein), gamma 11; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11; G protein gamma 11 subunit; GNGT11; guanine nucleotide binding protein G(I)/G(S)/G(O) gamma 11 subunit; G protein gamma-11 subunit; guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-11 subunit; |
Gene ID | 2791 |
mRNA Refseq | NM_004126 |
Protein Refseq | NP_004117 |
MIM | 604390 |
UniProt ID | P61952 |
◆ Recombinant Proteins | ||
GNG11-5328C | Recombinant Chicken GNG11 | +Inquiry |
GNG11-2606R | Recombinant Rat GNG11 Protein | +Inquiry |
GNG11-13360H | Recombinant Human GNG11, GST-tagged | +Inquiry |
GNG11-436H | Recombinant Human guanine nucleotide binding protein (G protein), gamma 11, His-tagged | +Inquiry |
GNG11-5064H | Recombinant Human GNG11 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNG11-5856HCL | Recombinant Human GNG11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNG11 Products
Required fields are marked with *
My Review for All GNG11 Products
Required fields are marked with *
0
Inquiry Basket