Recombinant Human GNG13 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GNG13-2629H |
Product Overview : | GNG13 MS Standard C13 and N15-labeled recombinant protein (NP_057625) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Heterotrimeric G proteins, which consist of alpha, beta, and gamma subunits, function as signal transducers for the 7-transmembrane-helix G protein-coupled receptors. GNG13 is a gamma subunit that is expressed in taste, retinal, and neuronal tissues and plays a key role in taste transduction. |
Molecular Mass : | 7.9 kDa |
AA Sequence : | MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTILTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GNG13 G protein subunit gamma 13 [ Homo sapiens (human) ] |
Official Symbol | GNG13 |
Synonyms | GNG13; G protein subunit gamma 13; h2-35; G(gamma)13; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13; G gamma subunit, clone:h2-35; guanine nucleotide binding protein (G protein), gamma 13; guanine nucleotide binding protein 13, gamma |
Gene ID | 51764 |
mRNA Refseq | NM_016541 |
Protein Refseq | NP_057625 |
MIM | 607298 |
UniProt ID | Q9P2W3 |
◆ Recombinant Proteins | ||
GNG13-1903R | Recombinant Rhesus monkey GNG13 Protein, His-tagged | +Inquiry |
Gng13-3262M | Recombinant Mouse Gng13 Protein, Myc/DDK-tagged | +Inquiry |
GNG13-3772M | Recombinant Mouse GNG13 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNG13-2629H | Recombinant Human GNG13 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GNG13-7035M | Recombinant Mouse GNG13 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNG13-5854HCL | Recombinant Human GNG13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNG13 Products
Required fields are marked with *
My Review for All GNG13 Products
Required fields are marked with *
0
Inquiry Basket