Recombinant Human GNG13 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : GNG13-2629H
Product Overview : GNG13 MS Standard C13 and N15-labeled recombinant protein (NP_057625) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Heterotrimeric G proteins, which consist of alpha, beta, and gamma subunits, function as signal transducers for the 7-transmembrane-helix G protein-coupled receptors. GNG13 is a gamma subunit that is expressed in taste, retinal, and neuronal tissues and plays a key role in taste transduction.
Molecular Mass : 7.9 kDa
AA Sequence : MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTILTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GNG13 G protein subunit gamma 13 [ Homo sapiens (human) ]
Official Symbol GNG13
Synonyms GNG13; G protein subunit gamma 13; h2-35; G(gamma)13; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13; G gamma subunit, clone:h2-35; guanine nucleotide binding protein (G protein), gamma 13; guanine nucleotide binding protein 13, gamma
Gene ID 51764
mRNA Refseq NM_016541
Protein Refseq NP_057625
MIM 607298
UniProt ID Q9P2W3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNG13 Products

Required fields are marked with *

My Review for All GNG13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon