Recombinant Human GNG5 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GNG5-6089H
• Product Overview: GNG5 MS Standard C13 and N15-labeled recombinant protein (NP_005265) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: G proteins are trimeric (alpha-beta-gamma) membrane-associated proteins that regulate flow of information from cell surface receptors to a variety of internal metabolic effectors. Interaction of a G protein with its activated receptor promotes exchange of GTP for GDP that is bound to the alpha subunit. The alpha-GTP complex dissociates from the beta-gamma heterodimer so that the subunits, in turn, may interact with and regulate effector molecules.
• Molecular Mass: 7.3 kDa
• AA Sequence: MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GNG5 G protein subunit gamma 5 [ Homo sapiens (human) ]
• Official Symbol: GNG5
• Synonyms: GNG5; guanine nucleotide binding protein (G protein), gamma 5; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5; FLJ92393
• Gene ID: 2787
• mRNA Refseq: NM_005274
• Protein Refseq: NP_005265
• MIM: 600874
• UniProt ID: P63218