Recombinant Human GNG5 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : GNG5-6089H
Product Overview : GNG5 MS Standard C13 and N15-labeled recombinant protein (NP_005265) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : G proteins are trimeric (alpha-beta-gamma) membrane-associated proteins that regulate flow of information from cell surface receptors to a variety of internal metabolic effectors. Interaction of a G protein with its activated receptor promotes exchange of GTP for GDP that is bound to the alpha subunit. The alpha-GTP complex dissociates from the beta-gamma heterodimer so that the subunits, in turn, may interact with and regulate effector molecules.
Molecular Mass : 7.3 kDa
AA Sequence : MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GNG5 G protein subunit gamma 5 [ Homo sapiens (human) ]
Official Symbol GNG5
Synonyms GNG5; guanine nucleotide binding protein (G protein), gamma 5; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5; FLJ92393;
Gene ID 2787
mRNA Refseq NM_005274
Protein Refseq NP_005265
MIM 600874
UniProt ID P63218

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNG5 Products

Required fields are marked with *

My Review for All GNG5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon