Recombinant Human GNG5 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GNG5-6089H |
Product Overview : | GNG5 MS Standard C13 and N15-labeled recombinant protein (NP_005265) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | G proteins are trimeric (alpha-beta-gamma) membrane-associated proteins that regulate flow of information from cell surface receptors to a variety of internal metabolic effectors. Interaction of a G protein with its activated receptor promotes exchange of GTP for GDP that is bound to the alpha subunit. The alpha-GTP complex dissociates from the beta-gamma heterodimer so that the subunits, in turn, may interact with and regulate effector molecules. |
Molecular Mass : | 7.3 kDa |
AA Sequence : | MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GNG5 G protein subunit gamma 5 [ Homo sapiens (human) ] |
Official Symbol | GNG5 |
Synonyms | GNG5; guanine nucleotide binding protein (G protein), gamma 5; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5; FLJ92393; |
Gene ID | 2787 |
mRNA Refseq | NM_005274 |
Protein Refseq | NP_005265 |
MIM | 600874 |
UniProt ID | P63218 |
◆ Recombinant Proteins | ||
GNG5-2262R | Recombinant Rat GNG5 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNG5-1906R | Recombinant Rhesus monkey GNG5 Protein, His-tagged | +Inquiry |
GNG5-1174HFL | Recombinant Full Length Human GNG5 Protein, C-Flag-tagged | +Inquiry |
GNG5-1001H | Recombinant Human GNG5 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNG5-1726R | Recombinant Rhesus Macaque GNG5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNG5-5851HCL | Recombinant Human GNG5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNG5 Products
Required fields are marked with *
My Review for All GNG5 Products
Required fields are marked with *