Recombinant Human GNG7
Cat.No. : | GNG7-28961TH |
Product Overview : | Recombinant full length Human G gamma7 with a N terminal proprietary tag; Predicted MW 33.59 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 68 amino acids |
Description : | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 is a protein that in humans is encoded by the GNG7 gene. |
Molecular Weight : | 33.590kDa inclusive of tags |
Tissue specificity : | Expressed in a variety of tissues. Down-regulated in pancreatic and esophageal cancer. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL |
Sequence Similarities : | Belongs to the G protein gamma family. |
Gene Name | GNG7 guanine nucleotide binding protein (G protein), gamma 7 [ Homo sapiens ] |
Official Symbol | GNG7 |
Synonyms | GNG7; guanine nucleotide binding protein (G protein), gamma 7; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7; FLJ00058; |
Gene ID | 2788 |
mRNA Refseq | NM_052847 |
Protein Refseq | NP_443079 |
MIM | 604430 |
Uniprot ID | O60262 |
Chromosome Location | 19p13.3 |
Pathway | ADP signalling through P2Y purinoceptor 1, organism-specific biosystem; ADP signalling through P2Y purinoceptor 12, organism-specific biosystem; Activation of G protein gated Potassium channels, organism-specific biosystem; Activation of GABAB receptors, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; |
Function | signal transducer activity; |
◆ Recombinant Proteins | ||
GNG7-2608R | Recombinant Rat GNG7 Protein | +Inquiry |
GNG7-2263R | Recombinant Rat GNG7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gng7-1038M | Recombinant Mouse Gng7 Protein, MYC/DDK-tagged | +Inquiry |
GNG7-6287H | Recombinant Human GNG7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GNG7-5391HF | Recombinant Full Length Human GNG7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNG7-5850HCL | Recombinant Human GNG7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNG7 Products
Required fields are marked with *
My Review for All GNG7 Products
Required fields are marked with *
0
Inquiry Basket