Recombinant Full Length Human GNG7 Protein, GST-tagged

Cat.No. : GNG7-5391HF
Product Overview : Human GNG7 full-length ORF ( AAH14466, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 68 amino acids
Description : GNG7 (G Protein Subunit Gamma 7) is a Protein Coding gene. Among its related pathways are Aquaporin-mediated transport and Immune response CCR3 signaling in eosinophils. GO annotations related to this gene include signal transducer activity. An important paralog of this gene is GNG12.
Molecular Mass : 33.22 kDa
AA Sequence : MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GNG7 guanine nucleotide binding protein (G protein), gamma 7 [ Homo sapiens ]
Official Symbol GNG7
Synonyms GNG7; guanine nucleotide binding protein (G protein), gamma 7; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7; FLJ00058;
Gene ID 2788
mRNA Refseq NM_052847
Protein Refseq NP_443079
MIM 604430
UniProt ID O60262

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNG7 Products

Required fields are marked with *

My Review for All GNG7 Products

Required fields are marked with *

0
cart-icon