Recombinant Full Length Human GNG7 Protein, GST-tagged
Cat.No. : | GNG7-5391HF |
Product Overview : | Human GNG7 full-length ORF ( AAH14466, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 68 amino acids |
Description : | GNG7 (G Protein Subunit Gamma 7) is a Protein Coding gene. Among its related pathways are Aquaporin-mediated transport and Immune response CCR3 signaling in eosinophils. GO annotations related to this gene include signal transducer activity. An important paralog of this gene is GNG12. |
Molecular Mass : | 33.22 kDa |
AA Sequence : | MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNG7 guanine nucleotide binding protein (G protein), gamma 7 [ Homo sapiens ] |
Official Symbol | GNG7 |
Synonyms | GNG7; guanine nucleotide binding protein (G protein), gamma 7; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7; FLJ00058; |
Gene ID | 2788 |
mRNA Refseq | NM_052847 |
Protein Refseq | NP_443079 |
MIM | 604430 |
UniProt ID | O60262 |
◆ Recombinant Proteins | ||
GNG7-1907R | Recombinant Rhesus monkey GNG7 Protein, His-tagged | +Inquiry |
GNG7-222HF | Recombinant Full Length Human GNG7 Protein | +Inquiry |
Gng7-1038M | Recombinant Mouse Gng7 Protein, MYC/DDK-tagged | +Inquiry |
GNG7-1727R | Recombinant Rhesus Macaque GNG7 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNG7-5073H | Recombinant Human GNG7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNG7-5850HCL | Recombinant Human GNG7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNG7 Products
Required fields are marked with *
My Review for All GNG7 Products
Required fields are marked with *