Recombinant Human GNGT2 protein, GST-tagged

Cat.No. : GNGT2-13367H
Product Overview : Recombinant Human GNGT2 protein(1-69 aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability November 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-69 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol GNGT2
Synonyms GNGT2; guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2; GNG9; G-gamma-9; g gamma-C; gamma-T2 subunit; G protein cone gamma 8 subunit; guanine nucleotide binding protein gamma 9; guanine nucleotide binding protein gamma transducing activity polypeptide 2; GNG8; GNGT8; G-GAMMA-8; G-GAMMA-C;
Gene ID 2793
mRNA Refseq NM_001198754
Protein Refseq NP_001185683
MIM 139391
UniProt ID O14610

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNGT2 Products

Required fields are marked with *

My Review for All GNGT2 Products

Required fields are marked with *

0
cart-icon
0
compare icon