Recombinant Human GNGT2 protein, GST-tagged
| Cat.No. : | GNGT2-13367H |
| Product Overview : | Recombinant Human GNGT2 protein(1-69 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | December 24, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-69 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | GNGT2 |
| Synonyms | GNGT2; guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2; GNG9; G-gamma-9; g gamma-C; gamma-T2 subunit; G protein cone gamma 8 subunit; guanine nucleotide binding protein gamma 9; guanine nucleotide binding protein gamma transducing activity polypeptide 2; GNG8; GNGT8; G-GAMMA-8; G-GAMMA-C; |
| Gene ID | 2793 |
| mRNA Refseq | NM_001198754 |
| Protein Refseq | NP_001185683 |
| MIM | 139391 |
| UniProt ID | O14610 |
| ◆ Recombinant Proteins | ||
| GNGT2-13367H | Recombinant Human GNGT2 protein, GST-tagged | +Inquiry |
| GNGT2-5602C | Recombinant Chicken GNGT2 | +Inquiry |
| GNGT2-1908R | Recombinant Rhesus monkey GNGT2 Protein, His-tagged | +Inquiry |
| GNGT2-1503H | Recombinant Human GNGT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GNGT2-5394HF | Recombinant Full Length Human GNGT2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GNGT2-5849HCL | Recombinant Human GNGT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNGT2 Products
Required fields are marked with *
My Review for All GNGT2 Products
Required fields are marked with *
