Recombinant Human GNGT2 Protein, GST-tagged
| Cat.No. : | GNGT2-5077H |
| Product Overview : | Human GNGT2 full-length ORF ( AAH08663, 1 a.a. - 69 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. There is evidence for use of multiple polyadenylation sites by this gene. [provided by RefSeq |
| Molecular Mass : | 33.33 kDa |
| AA Sequence : | MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GNGT2 guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 [ Homo sapiens ] |
| Official Symbol | GNGT2 |
| Synonyms | GNGT2; guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2; GNG9; G-gamma-9; g gamma-C; gamma-T2 subunit; G protein cone gamma 8 subunit; guanine nucleotide binding protein gamma 9; guanine nucleotide binding protein gamma transducing activity polypeptide 2; GNG8; GNGT8; G-GAMMA-8; G-GAMMA-C; |
| Gene ID | 2793 |
| mRNA Refseq | NM_001198754 |
| Protein Refseq | NP_001185683 |
| MIM | 139391 |
| UniProt ID | O14610 |
| ◆ Recombinant Proteins | ||
| GNGT2-13367H | Recombinant Human GNGT2 protein, GST-tagged | +Inquiry |
| Gngt2-1040M | Recombinant Mouse Gngt2 Protein, MYC/DDK-tagged | +Inquiry |
| GNGT2-1908R | Recombinant Rhesus monkey GNGT2 Protein, His-tagged | +Inquiry |
| GNGT2-1728R | Recombinant Rhesus Macaque GNGT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GNGT2-1503H | Recombinant Human GNGT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GNGT2-5849HCL | Recombinant Human GNGT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNGT2 Products
Required fields are marked with *
My Review for All GNGT2 Products
Required fields are marked with *




