Recombinant Human GNL2 protein(551-700 aa), C-His-tagged

• Cat.No.: GNL2-2862H
• Product Overview: Recombinant Human GNL2 protein(Q13823)(551-700 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 551-700 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: EVSDLEEELESFSDEEEEEQEQQRDDAEESSSEPEEENVGNDTKAVIKALDEKIAKYQKFLDKAKAKKFSAVRISKGLSEKIFAKPEEQRKTLEEDVDDRAPSKKGKKRKAQREEEQEHSNKAPRALTSKERRRAVRQQRPKKVGVRYYE

Gene Information

• Gene Name: GNL2 guanine nucleotide binding protein-like 2 (nucleolar) [ Homo sapiens ]
• Official Symbol: GNL2
• Synonyms: GNL2; guanine nucleotide binding protein-like 2 (nucleolar); nucleolar GTP-binding protein 2; HUMAUANTIG; Ngp 1; nucleolar GTPase; autoantigen NGP-1; nucleolar G-protein gene 1; novel nucleolar guanosine 5-triphosphate binding protein autoantigen; NGP1; Ngp-1; FLJ40906
• Gene ID: 29889
• mRNA Refseq: NM_013285
• Protein Refseq: NP_037417
• MIM: 609365
• UniProt ID: Q13823