Recombinant Human GNL2 protein(551-700 aa), C-His-tagged

Cat.No. : GNL2-2862H
Product Overview : Recombinant Human GNL2 protein(Q13823)(551-700 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 551-700 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : EVSDLEEELESFSDEEEEEQEQQRDDAEESSSEPEEENVGNDTKAVIKALDEKIAKYQKFLDKAKAKKFSAVRISKGLSEKIFAKPEEQRKTLEEDVDDRAPSKKGKKRKAQREEEQEHSNKAPRALTSKERRRAVRQQRPKKVGVRYYE
Gene Name GNL2 guanine nucleotide binding protein-like 2 (nucleolar) [ Homo sapiens ]
Official Symbol GNL2
Synonyms GNL2; guanine nucleotide binding protein-like 2 (nucleolar); nucleolar GTP-binding protein 2; HUMAUANTIG; Ngp 1; nucleolar GTPase; autoantigen NGP-1; nucleolar G-protein gene 1; novel nucleolar guanosine 5-triphosphate binding protein autoantigen; NGP1; Ngp-1; FLJ40906;
Gene ID 29889
mRNA Refseq NM_013285
Protein Refseq NP_037417
MIM 609365
UniProt ID Q13823

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNL2 Products

Required fields are marked with *

My Review for All GNL2 Products

Required fields are marked with *

0
cart-icon