Recombinant Human GNL2 protein(551-700 aa), C-His-tagged
Cat.No. : | GNL2-2862H |
Product Overview : | Recombinant Human GNL2 protein(Q13823)(551-700 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 551-700 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | EVSDLEEELESFSDEEEEEQEQQRDDAEESSSEPEEENVGNDTKAVIKALDEKIAKYQKFLDKAKAKKFSAVRISKGLSEKIFAKPEEQRKTLEEDVDDRAPSKKGKKRKAQREEEQEHSNKAPRALTSKERRRAVRQQRPKKVGVRYYE |
Gene Name | GNL2 guanine nucleotide binding protein-like 2 (nucleolar) [ Homo sapiens ] |
Official Symbol | GNL2 |
Synonyms | GNL2; guanine nucleotide binding protein-like 2 (nucleolar); nucleolar GTP-binding protein 2; HUMAUANTIG; Ngp 1; nucleolar GTPase; autoantigen NGP-1; nucleolar G-protein gene 1; novel nucleolar guanosine 5-triphosphate binding protein autoantigen; NGP1; Ngp-1; FLJ40906; |
Gene ID | 29889 |
mRNA Refseq | NM_013285 |
Protein Refseq | NP_037417 |
MIM | 609365 |
UniProt ID | Q13823 |
◆ Recombinant Proteins | ||
GNL2-2862H | Recombinant Human GNL2 protein(551-700 aa), C-His-tagged | +Inquiry |
GNL2-28149TH | Recombinant Human GNL2, His-tagged | +Inquiry |
GNL2-4403H | Recombinant Human GNL2 protein, His-SUMO-tagged | +Inquiry |
GNL2-12427Z | Recombinant Zebrafish GNL2 | +Inquiry |
GNL2-2861H | Recombinant Human GNL2 protein(441-700 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNL2-723HCL | Recombinant Human GNL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNL2 Products
Required fields are marked with *
My Review for All GNL2 Products
Required fields are marked with *