Recombinant Human GNPDA1
| Cat.No. : | GNPDA1-28076TH |
| Product Overview : | Recombinant full length Human GNPDA1, expressed in Saccharomyces cerevisiae, amino acids 1-289, 33 kDa, |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Tag : | Non |
| Protein Length : | 1-289 a.a. |
| Description : | Glucosamine-6-phosphate deaminase (EC 3.5.99.6) is an allosteric enzyme that catalyzes the reversible conversion of D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium (Arreola et al. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MKLIILEHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLP TGSTPLGCYKKLIEYYKNGDLSFKYVKTFNMDEYVGLP RDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQA ECDAFEEKIKAAGGIELFVGGIGPDGHIAFNEPGSSLVSR TRVKTLAMDTILANARFFDGELTKVPTMALTVGVGTVM DAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQH PRTVFVCDEDATLELKVKTVKY |
| Sequence Similarities : | Belongs to the glucosamine/galactosamine-6-phosphate isomerase family. |
| Full Length : | Full L. |
| Gene Name | GNPDA1 glucosamine-6-phosphate deaminase 1 [ Homo sapiens ] |
| Official Symbol | GNPDA1 |
| Synonyms | GNPDA1; glucosamine-6-phosphate deaminase 1; glucosamine 6 phosphate isomerase , GNPI; glucosamine-6-phosphate isomerase 1; glucosamine 6 phosphate deaminase; GNPDA; GPI; HLN; KIAA0060; oscillin; |
| Gene ID | 10007 |
| mRNA Refseq | NM_005471 |
| Protein Refseq | NP_005462 |
| MIM | 601798 |
| Uniprot ID | P46926 |
| Chromosome Location | 5q21 |
| Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
| Function | glucosamine-6-phosphate deaminase activity; hydrolase activity; |
| ◆ Recombinant Proteins | ||
| GNPDA1-3782M | Recombinant Mouse GNPDA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GNPDA1-2810H | Recombinant Human Glucosamine-6-phosphate Deaminase 1, His-tagged | +Inquiry |
| GNPDA1-236H | Recombinant Human GNPDA1 protein, T7/His-tagged | +Inquiry |
| GNPDA1-1732R | Recombinant Rhesus Macaque GNPDA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GNPDA1-13375H | Recombinant Human GNPDA1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GNPDA1-724HCL | Recombinant Human GNPDA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNPDA1 Products
Required fields are marked with *
My Review for All GNPDA1 Products
Required fields are marked with *
