Recombinant Human GOLM1 Protein, GST-tagged
| Cat.No. : | GOLM1-5112H |
| Product Overview : | Human GOLM1 partial ORF ( NP_057632, 302 a.a. - 401 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | VQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GOLM1 golgi membrane protein 1 [ Homo sapiens ] |
| Official Symbol | GOLM1 |
| Synonyms | GOLM1; golgi membrane protein 1; C9orf155, chromosome 9 open reading frame 155, golgi phosphoprotein 2, GOLPH2; Golgi membrane protein 1; bA379P1.3; FLJ23608; GP73; golgi protein, 73-kD; golgi phosphoprotein 2; golgi membrane protein GP73; GOLPH2; C9orf155; PSEC0257; FLJ22634; |
| Gene ID | 51280 |
| mRNA Refseq | NM_016548 |
| Protein Refseq | NP_057632 |
| MIM | 606804 |
| UniProt ID | Q8NBJ4 |
| ◆ Recombinant Proteins | ||
| GOLM1-5112H | Recombinant Human GOLM1 Protein, GST-tagged | +Inquiry |
| GOLM1-13387H | Recombinant Human GOLM1, GST-tagged | +Inquiry |
| GOLM1-1781H | Recombinant Human GOLM1 protein, His & GST-tagged | +Inquiry |
| GOLM1-4824H | Recombinant Human GOLM1 Protein (Val40-Leu401), C-His tagged | +Inquiry |
| GOLM1-3916H | Recombinant Human GOLM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GOLM1-1856HCL | Recombinant Human GOLM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GOLM1 Products
Required fields are marked with *
My Review for All GOLM1 Products
Required fields are marked with *
