Recombinant Human GON7 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : GON7-501H
Product Overview : C14orf142 MS Standard C13 and N15-labeled recombinant protein (NP_115879) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t6A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. GON7 likely plays a supporting role to the catalytic subunit OSGEP in the complex.
Molecular Mass : 10.9 kDa
AA Sequence : MELLGEYVGQEGKPQKLRVSCEAPGDGDPFQGLLSGVAQMKDMVTELFDPLVQGEVQHRVAAAPDEDLDGDDEDDAEDENNIDNRTNFDGPSAKRPKTPSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GON7 GON7 subunit of KEOPS complex [ Homo sapiens (human) ]
Official Symbol GON7
Synonyms GON7; GON7 subunit of KEOPS complex; PNAS-127; C14orf142; EKC/KEOPS complex subunit GON7; GON7, KEOPS complex subunit homolog; uncharacterized protein C14orf142
Gene ID 84520
mRNA Refseq NM_032490
Protein Refseq NP_115879
MIM 617436
UniProt ID Q9BXV9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GON7 Products

Required fields are marked with *

My Review for All GON7 Products

Required fields are marked with *

0
cart-icon
0
compare icon