Recombinant Human GON7 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GON7-501H |
Product Overview : | C14orf142 MS Standard C13 and N15-labeled recombinant protein (NP_115879) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t6A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. GON7 likely plays a supporting role to the catalytic subunit OSGEP in the complex. |
Molecular Mass : | 10.9 kDa |
AA Sequence : | MELLGEYVGQEGKPQKLRVSCEAPGDGDPFQGLLSGVAQMKDMVTELFDPLVQGEVQHRVAAAPDEDLDGDDEDDAEDENNIDNRTNFDGPSAKRPKTPSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GON7 GON7 subunit of KEOPS complex [ Homo sapiens (human) ] |
Official Symbol | GON7 |
Synonyms | GON7; GON7 subunit of KEOPS complex; PNAS-127; C14orf142; EKC/KEOPS complex subunit GON7; GON7, KEOPS complex subunit homolog; uncharacterized protein C14orf142 |
Gene ID | 84520 |
mRNA Refseq | NM_032490 |
Protein Refseq | NP_115879 |
MIM | 617436 |
UniProt ID | Q9BXV9 |
◆ Recombinant Proteins | ||
GON7-616H | Recombinant Human GON7 Protein, MYC/DDK-tagged | +Inquiry |
GON7-501H | Recombinant Human GON7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GON7 Products
Required fields are marked with *
My Review for All GON7 Products
Required fields are marked with *