Recombinant Human GP1BA protein, His&Myc-tagged
Cat.No. : | GP1BA-2984H |
Product Overview : | Recombinant Human GP1BA protein(P07359)(553-652aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 553-652aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.9 kDa |
AA Sequence : | SWVGHVKPQALDSGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYSGHSL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GP1BA glycoprotein Ib (platelet), alpha polypeptide [ Homo sapiens ] |
Official Symbol | GP1BA |
Synonyms | GP1BA; glycoprotein Ib (platelet), alpha polypeptide; GP1B; platelet glycoprotein Ib alpha chain; CD42b; GP-Ib alpha; antigen CD42b-alpha; platelet membrane glycoprotein 1b-alpha subunit; BSS; VWDP; CD42B; GPIbA; BDPLT1; BDPLT3; DBPLT3; CD42b-alpha; MGC34595; |
Gene ID | 2811 |
mRNA Refseq | NM_000173 |
Protein Refseq | NP_000164 |
MIM | 606672 |
UniProt ID | P07359 |
◆ Recombinant Proteins | ||
GP1BA-21M | Active Recombinant Mouse GP1BA Protein, C-His-tagged | +Inquiry |
GP1BA-2983H | Recombinant Human GP1BA protein, GST-tagged | +Inquiry |
GP1BA-2341H | Recombinant Human GP1BA Protein (Leu136-Pro276), His tagged | +Inquiry |
GP1BA-1401H | Recombinant Human GP1BA Protein (17-531 aa), His-tagged | +Inquiry |
GP1BA-21H | Recombinant Human GP1BA, His-tagged, Single-sulfated | +Inquiry |
◆ Cell & Tissue Lysates | ||
GP1BA-5823HCL | Recombinant Human GP1BA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GP1BA Products
Required fields are marked with *
My Review for All GP1BA Products
Required fields are marked with *