Recombinant Human GP1BA protein, His&Myc-tagged
| Cat.No. : | GP1BA-2984H |
| Product Overview : | Recombinant Human GP1BA protein(P07359)(553-652aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 553-652aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 15.9 kDa |
| AA Sequence : | SWVGHVKPQALDSGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYSGHSL |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | GP1BA glycoprotein Ib (platelet), alpha polypeptide [ Homo sapiens ] |
| Official Symbol | GP1BA |
| Synonyms | GP1BA; glycoprotein Ib (platelet), alpha polypeptide; GP1B; platelet glycoprotein Ib alpha chain; CD42b; GP-Ib alpha; antigen CD42b-alpha; platelet membrane glycoprotein 1b-alpha subunit; BSS; VWDP; CD42B; GPIbA; BDPLT1; BDPLT3; DBPLT3; CD42b-alpha; MGC34595; |
| Gene ID | 2811 |
| mRNA Refseq | NM_000173 |
| Protein Refseq | NP_000164 |
| MIM | 606672 |
| UniProt ID | P07359 |
| ◆ Recombinant Proteins | ||
| GP1BA-21H | Recombinant Human GP1BA, His-tagged, Single-sulfated | +Inquiry |
| GP1BA-531H | Recombinant Human GP1BA Protein (17-505 aa), His-tagged | +Inquiry |
| GP1BA-19H | Recombinant Human glycoprotein Ibα, His-tagged, non-sulfated | +Inquiry |
| GP1BA-16H | Recombinant Human GP1BA Protein, His-tagged | +Inquiry |
| GP1BA-18H | Recombinant Human glycoprotein Ibα, His-tagged, fully sulfated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GP1BA-5823HCL | Recombinant Human GP1BA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GP1BA Products
Required fields are marked with *
My Review for All GP1BA Products
Required fields are marked with *
