Recombinant Human GP1BB Protein
Cat.No. : | GP1BB-5132H |
Product Overview : | Human GP1BB full-length ORF (AAI60146.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | Platelet glycoprotein Ib (GPIb) is a heterodimeric transmembrane protein consisting of a disulfide-linked 140 kD alpha chain and 22 kD beta chain. It is part of the GPIb-V-IX system that constitutes the receptor for von Willebrand factor (VWF), and mediates platelet adhesion in the arterial circulation. GPIb alpha chain provides the VWF binding site, and GPIb beta contributes to surface expression of the receptor and participates in transmembrane signaling through phosphorylation of its intracellular domain. Mutations in the GPIb beta subunit have been associated with Bernard-Soulier syndrome, velocardiofacial syndrome and giant platelet disorder. The 206 amino acid precursor of GPIb beta is synthesized from a 1.0 kb mRNA expressed in plateletes and megakaryocytes. A 411 amino acid protein arising from a longer, unspliced transcript in endothelial cells has been described; however, the authenticity of this product has been questioned. Yet another less abundant GPIb beta mRNA species of 3.5 kb, expressed in nonhematopoietic tissues such as endothelium, brain and heart, was shown to result from inefficient usage of a non-consensus polyA signal within a separate gene (septin 5) located upstream of this gene. In the absence of polyadenylation from its own imperfect site, the septin 5 gene uses the consensus polyA signal of this gene. [provided by RefSeq |
Form : | Liquid |
Molecular Mass : | 22.7 kDa |
AA Sequence : | MGSGPRGALSLLLLLLAPPSRPAAGCPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | GP1BB glycoprotein Ib (platelet), beta polypeptide [ Homo sapiens ] |
Official Symbol | GP1BB |
Synonyms | GP1BB; glycoprotein Ib (platelet), beta polypeptide; platelet glycoprotein Ib beta chain; CD42c; GPIb-beta; GP-Ib beta; antigen CD42b-beta; nuclear localization signal deleted in velocardiofacial syndrome; BS; CD42C; GPIBB; BDPLT1; |
Gene ID | 2812 |
mRNA Refseq | NM_000407 |
Protein Refseq | NP_000398 |
MIM | 138720 |
UniProt ID | P13224 |
◆ Recombinant Proteins | ||
GP1BB-7296Z | Recombinant Zebrafish GP1BB | +Inquiry |
RFL7798HF | Recombinant Full Length Human Platelet Glycoprotein Ib Beta Chain(Gp1Bb) Protein, His&Myc-Tagged | +Inquiry |
GP1BB-2625R | Recombinant Rat GP1BB Protein | +Inquiry |
GP1BB-2280R | Recombinant Rat GP1BB Protein, His (Fc)-Avi-tagged | +Inquiry |
GP1BB-5463HF | Recombinant Full Length Human GP1BB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GP1BB-1243RCL | Recombinant Rat GP1BB cell lysate | +Inquiry |
GP1BB-2588HCL | Recombinant Human GP1BB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GP1BB Products
Required fields are marked with *
My Review for All GP1BB Products
Required fields are marked with *