Recombinant Human GPATCH2 Protein, GST-tagged
Cat.No. : | GPATCH2-5140H |
Product Overview : | Human GPATCH2 full-length ORF ( AAH63474.1, 1 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The gene encodes a nuclear factor that may play a role in spermatogenesis and in tumor growth during breast cancer. The encoded protein contains a G-patch domain with an RNA binding motif. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2017] |
Molecular Mass : | 69 kDa |
AA Sequence : | MFGAAGRQPIGAPAAGNSWHFSRTMEELVHDLVSALEESSEQARGGFAETGDHSRSISCPLKRQARKRRGRKRRSYNVHHPWETGHCLSEGSDSSLEEPSKDYRENHNNNKKDHSDSDDQMLVAKRRPSSNLNNNVRGKRPLWHESDFAVDNVGNRTLRRRRKVKRMAVDLPQDISNKRTMTQPPEGCRDQDMDSDRAYQYQEFTKNKVKKRKLKIIRQAPKIQDEGVVLESEETNQTNKDKMECEEQKVSDELMSESDSSSLSSTDAGLFTNDEGRQGDDEQSDWFYEKESGGACGITGVVPWWEKEDPTELDKNVPDPVFESILTGSFPLMSHPSRRGFQARLSRLHGMSSKNIKKSGGTPTSMATNWTSEIPL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPATCH2 G patch domain containing 2 [ Homo sapiens ] |
Official Symbol | GPATCH2 |
Synonyms | GPATCH2; G patch domain containing 2; GPATC2; G patch domain-containing protein 2; cancer/testis antigen 110; CT110; FLJ10252; PPP1R30; protein phosphatase 1; regulatory subunit 30; protein phosphatase 1, regulatory subunit 30; FLJ21048; MGC74998; RP11-361K17.1; |
Gene ID | 55105 |
mRNA Refseq | NM_018040 |
Protein Refseq | NP_060510 |
MIM | 616836 |
UniProt ID | Q9NW75 |
◆ Recombinant Proteins | ||
GPATCH2-2726C | Recombinant Chicken GPATCH2 | +Inquiry |
GPATCH2-5140H | Recombinant Human GPATCH2 Protein, GST-tagged | +Inquiry |
GPATCH2-7092M | Recombinant Mouse GPATCH2 Protein | +Inquiry |
GPATCH2-5492HF | Recombinant Full Length Human GPATCH2 Protein, GST-tagged | +Inquiry |
GPATCH2-3816M | Recombinant Mouse GPATCH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPATCH2-731HCL | Recombinant Human GPATCH2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPATCH2 Products
Required fields are marked with *
My Review for All GPATCH2 Products
Required fields are marked with *