Recombinant Human GPATCH2 Protein, GST-tagged

Cat.No. : GPATCH2-5140H
Product Overview : Human GPATCH2 full-length ORF ( AAH63474.1, 1 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The gene encodes a nuclear factor that may play a role in spermatogenesis and in tumor growth during breast cancer. The encoded protein contains a G-patch domain with an RNA binding motif. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2017]
Molecular Mass : 69 kDa
AA Sequence : MFGAAGRQPIGAPAAGNSWHFSRTMEELVHDLVSALEESSEQARGGFAETGDHSRSISCPLKRQARKRRGRKRRSYNVHHPWETGHCLSEGSDSSLEEPSKDYRENHNNNKKDHSDSDDQMLVAKRRPSSNLNNNVRGKRPLWHESDFAVDNVGNRTLRRRRKVKRMAVDLPQDISNKRTMTQPPEGCRDQDMDSDRAYQYQEFTKNKVKKRKLKIIRQAPKIQDEGVVLESEETNQTNKDKMECEEQKVSDELMSESDSSSLSSTDAGLFTNDEGRQGDDEQSDWFYEKESGGACGITGVVPWWEKEDPTELDKNVPDPVFESILTGSFPLMSHPSRRGFQARLSRLHGMSSKNIKKSGGTPTSMATNWTSEIPL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPATCH2 G patch domain containing 2 [ Homo sapiens ]
Official Symbol GPATCH2
Synonyms GPATCH2; G patch domain containing 2; GPATC2; G patch domain-containing protein 2; cancer/testis antigen 110; CT110; FLJ10252; PPP1R30; protein phosphatase 1; regulatory subunit 30; protein phosphatase 1, regulatory subunit 30; FLJ21048; MGC74998; RP11-361K17.1;
Gene ID 55105
mRNA Refseq NM_018040
Protein Refseq NP_060510
MIM 616836
UniProt ID Q9NW75

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPATCH2 Products

Required fields are marked with *

My Review for All GPATCH2 Products

Required fields are marked with *

0
cart-icon
0
compare icon