Recombinant Human GPBAR1 protein, His-KSI-tagged
| Cat.No. : | GPBAR1-6874H |
| Product Overview : | Recombinant Human GPBAR1 protein(Q8TDU6)(283-330aa), fused with N-terminal His and KSI tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&KSI |
| Protein Length : | 283-330a.a. |
| Tag : | His-KSI |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 20.6 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN |
| Gene Name | GPBAR1 G protein-coupled bile acid receptor 1 [ Homo sapiens ] |
| Official Symbol | GPBAR1 |
| Synonyms | BG37; TGR5; M-BAR; GPCR19; GPR131 |
| Gene ID | 151306 |
| mRNA Refseq | NM_170699.2 |
| Protein Refseq | NP_733800.1 |
| MIM | 610147 |
| UniProt ID | Q8TDU6 |
| ◆ Recombinant Proteins | ||
| GPBAR1-2629R | Recombinant Rat GPBAR1 Protein | +Inquiry |
| RFL36667OF | Recombinant Full Length Rabbit G-Protein Coupled Bile Acid Receptor 1(Gpbar1) Protein, His-Tagged | +Inquiry |
| GPBAR1-2920H | Recombinant Human GPBAR1 protein, His-tagged | +Inquiry |
| RFL13484BF | Recombinant Full Length Bovine G-Protein Coupled Bile Acid Receptor 1(Gpbar1) Protein, His-Tagged | +Inquiry |
| GPBAR1-1928R | Recombinant Rhesus monkey GPBAR1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GPBAR1-5814HCL | Recombinant Human GPBAR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPBAR1 Products
Required fields are marked with *
My Review for All GPBAR1 Products
Required fields are marked with *
