Recombinant Human GPC1 Protein, GST-tagged
Cat.No. : | GPC1-5145H |
Product Overview : | Human GPC1 partial ORF ( NP_002072, 24 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. [provided by RefSeq |
Molecular Mass : | 37.62 kDa |
AA Sequence : | DPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPC1 glypican 1 [ Homo sapiens ] |
Official Symbol | GPC1 |
Synonyms | GPC1; glypican 1; glypican-1; glypican; glypican proteoglycan 1; FLJ38078; |
Gene ID | 2817 |
mRNA Refseq | NM_002081 |
Protein Refseq | NP_002072 |
MIM | 600395 |
UniProt ID | P35052 |
◆ Recombinant Proteins | ||
GPC1-2286R | Recombinant Rat GPC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPC1-152H | Recombinant Human GPC1 protein, His-tagged | +Inquiry |
GPC1-624H | Recombinant Human GPC1 protein, Fc-tagged | +Inquiry |
GPC1-2631R | Recombinant Rat GPC1 Protein | +Inquiry |
GPC1-3058H | Recombinant Human GPC1 Protein (Asp24-Thr529), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPC1 Products
Required fields are marked with *
My Review for All GPC1 Products
Required fields are marked with *