Recombinant Human GPC1 Protein, GST-tagged

Cat.No. : GPC1-5145H
Product Overview : Human GPC1 partial ORF ( NP_002072, 24 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. [provided by RefSeq
Molecular Mass : 37.62 kDa
AA Sequence : DPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPC1 glypican 1 [ Homo sapiens ]
Official Symbol GPC1
Synonyms GPC1; glypican 1; glypican-1; glypican; glypican proteoglycan 1; FLJ38078;
Gene ID 2817
mRNA Refseq NM_002081
Protein Refseq NP_002072
MIM 600395
UniProt ID P35052

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPC1 Products

Required fields are marked with *

My Review for All GPC1 Products

Required fields are marked with *

0
cart-icon