Recombinant Human GPC1 Protein, GST-tagged

• Cat.No.: GPC1-5145H
• Product Overview: Human GPC1 partial ORF ( NP_002072, 24 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. [provided by RefSeq
• Molecular Mass: 37.62 kDa
• AA Sequence: DPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPC1 glypican 1 [ Homo sapiens ]
• Official Symbol: GPC1
• Synonyms: GPC1; glypican 1; glypican-1; glypican; glypican proteoglycan 1; FLJ38078
• Gene ID: 2817
• mRNA Refseq: NM_002081
• Protein Refseq: NP_002072
• MIM: 600395
• UniProt ID: P35052