Recombinant Human GPC3
Cat.No. : | GPC3-27455TH |
Product Overview : | Recombinant fragment corresponding to amino acids 121-220 of Human Glypican 3 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. The protein encoded by this gene can bind to and inhibit the dipeptidyl peptidase activity of CD26, and it can induce apoptosis in certain cell types. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome, also known as Simpson dysmorphia syndrome. Alternative splicing results in multiple transcript variants. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Highly expressed in lung, liver and kidney. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | HAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVS |
Sequence Similarities : | Belongs to the glypican family. |
Gene Name | GPC3 glypican 3 [ Homo sapiens ] |
Official Symbol | GPC3 |
Synonyms | GPC3; glypican 3; SDYS; glypican-3; DGSX; glypican proteoglycan 3; OCI 5; SGB; SGBS; SGBS1; |
Gene ID | 2719 |
mRNA Refseq | NM_001164617 |
Protein Refseq | NP_001158089 |
MIM | 300037 |
Uniprot ID | P51654 |
Chromosome Location | Xq26 |
Pathway | Glypican 3 network, organism-specific biosystem; Glypican pathway, organism-specific biosystem; |
Function | heparan sulfate proteoglycan binding; peptidyl-dipeptidase inhibitor activity; protein binding; |
◆ Recombinant Proteins | ||
GPC3-271H | Recombinant Human GPC3 Protein, His-tagged | +Inquiry |
GPC3-50CPAF555 | Recombinant Monkey GPC3 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
GPC3-2246H | Recombinant Human GPC3 protein (S359F), His-tagged, low endotoxin | +Inquiry |
GPC3-1305R | Active Recombinant Rat GPC3 protein, His-tagged | +Inquiry |
GPC3-1514H | Active Recombinant Human GPC3 protein, lFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPC3-001MCL | Recombinant Mouse GPC3 cell lysate | +Inquiry |
GPC3-2538HCL | Recombinant Human GPC3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPC3 Products
Required fields are marked with *
My Review for All GPC3 Products
Required fields are marked with *