Recombinant Human GPER Protein, GST-tagged
Cat.No. : | GPER-5230H |
Product Overview : | Human GPR30 full-length ORF ( NP_001496.1, 1 a.a. - 375 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the G-protein coupled receptor 1 family and encodes a multi-pass membrane protein that localizes to the endoplasmic reticulum. The protein binds estrogen, resulting in intracellular calcium mobilization and synthesis of phosphatidylinositol 3,4,5-trisphosphate in the nucleus. This protein therefore plays a role in the rapid nongenomic signaling events widely observed following stimulation of cells and tissues with estrogen. Alternate transcriptional splice variants which encode the same protein have been characterized. [provided by RefSeq |
Molecular Mass : | 68.6 kDa |
AA Sequence : | MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPER G protein-coupled estrogen receptor 1 [ Homo sapiens ] |
Official Symbol | GPER |
Synonyms | GPER; G protein-coupled estrogen receptor 1; CMKRL2, G protein coupled receptor 30, GPR30; G-protein coupled estrogen receptor 1; CEPR; DRY12; FEG 1; GPCR Br; LERGU; LERGU2; LyGPR; mER; heptahelix receptor; chemokine receptor-like 2; IL8-related receptor DRY12; membrane estrogen receptor; G protein-coupled receptor 30; G-protein coupled receptor 30; chemoattractant receptor-like 2; leucine rich protein in GPR30 3UTR; lymphocyte-derived G-protein coupled receptor; constitutively expressed peptide-like receptor; flow-induced endothelial G-protein coupled receptor 1; FEG-1; GPR30; CMKRL2; GPCR-Br; MGC99678; |
Gene ID | 2852 |
mRNA Refseq | NM_001039966 |
Protein Refseq | NP_001035055 |
MIM | 601805 |
UniProt ID | Q99527 |
◆ Recombinant Proteins | ||
GPER-2291R | Recombinant Rat GPER Protein, His (Fc)-Avi-tagged | +Inquiry |
GPER-5532HF | Recombinant Full Length Human GPER Protein, GST-tagged | +Inquiry |
GPER-2637R | Recombinant Rat GPER Protein | +Inquiry |
GPER-5230H | Recombinant Human GPER Protein, GST-tagged | +Inquiry |
GPER-5528HF | Recombinant Full Length Human GPER Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPER Products
Required fields are marked with *
My Review for All GPER Products
Required fields are marked with *