Recombinant Human GPHA2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | GPHA2-2867H |
| Product Overview : | GPHA2 MS Standard C13 and N15-labeled recombinant protein (NP_570125) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | GPHA2 is a cystine knot-forming polypeptide and a subunit of the dimeric glycoprotein hormone family. |
| Molecular Mass : | 14.2 kDa |
| AA Sequence : | MPMASPQTLVLYLLVLAVTEAWGQEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | GPHA2 glycoprotein hormone alpha 2 [ Homo sapiens (human) ] |
| Official Symbol | GPHA2 |
| Synonyms | GPHA2; glycoprotein hormone alpha 2; glycoprotein hormone alpha-2; A2; cysteine knot protein; glycoprotein alpha 2; GPA2; MGC126572; ZSIG51; thyrostimulin subunit alpha; putative secreted protein Zsig51; |
| Gene ID | 170589 |
| mRNA Refseq | NM_130769 |
| Protein Refseq | NP_570125 |
| MIM | 609651 |
| UniProt ID | Q96T91 |
| ◆ Recombinant Proteins | ||
| GPHA2-250H | Recombinant Human GPHA2, His tagged | +Inquiry |
| GPHA2-2867H | Recombinant Human GPHA2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Gpha2-3287M | Recombinant Mouse Gpha2 Protein, Myc/DDK-tagged | +Inquiry |
| GPHA2-227H | Recombinant Human GPHA2, Fc tagged | +Inquiry |
| GPHA2-1933R | Recombinant Rhesus monkey GPHA2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GPHA2-923HCL | Recombinant Human GPHA2 cell lysate | +Inquiry |
| GPHA2-905HCL | Recombinant Human GPHA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPHA2 Products
Required fields are marked with *
My Review for All GPHA2 Products
Required fields are marked with *



