Recombinant Human GPR12 Protein, GST-tagged
Cat.No. : | GPR12-5178H |
Product Overview : | Human GPR12 full-length ORF ( NP_005279.1, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GPR12 (G Protein-Coupled Receptor 12) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity and phosphatidylcholine binding. An important paralog of this gene is GPR6. |
Molecular Mass : | 63.1 kDa |
AA Sequence : | MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCTSGTLISCENAIVVLIIFHNPSLRAPMFLLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLIVASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLATSHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPR12 G protein-coupled receptor 12 [ Homo sapiens ] |
Official Symbol | GPR12 |
Synonyms | GPR12; G protein-coupled receptor 12; G-protein coupled receptor 12; GPCR21; GPCR12; FLJ18149; FLJ97704; MGC138349; MGC138351; |
Gene ID | 2835 |
mRNA Refseq | NM_005288 |
Protein Refseq | NP_005279 |
MIM | 600752 |
UniProt ID | P47775 |
◆ Recombinant Proteins | ||
GPR12-2649R | Recombinant Rat GPR12 Protein | +Inquiry |
GPR12-202HF | Recombinant Full Length Human GPR12 Protein | +Inquiry |
RFL2664HF | Recombinant Full Length Human G-Protein Coupled Receptor 12(Gpr12) Protein, His-Tagged | +Inquiry |
GPR12-2303R | Recombinant Rat GPR12 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPR12-29093TH | Recombinant Human GPR12 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR12 Products
Required fields are marked with *
My Review for All GPR12 Products
Required fields are marked with *