Recombinant Full Length Human GPR12 Protein, GST-tagged
| Cat.No. : | GPR12-5614HF |
| Product Overview : | Human GPR12 full-length ORF ( NP_005279.1, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 334 amino acids |
| Description : | GPR12 (G Protein-Coupled Receptor 12) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity and phosphatidylcholine binding. An important paralog of this gene is GPR6. |
| Molecular Mass : | 63.1 kDa |
| AA Sequence : | MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCTSGTLISCENAIVVLIIFHNPSLRAPMFLLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLIVASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLATSHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GPR12 G protein-coupled receptor 12 [ Homo sapiens ] |
| Official Symbol | GPR12 |
| Synonyms | GPR12; G protein-coupled receptor 12; G-protein coupled receptor 12; GPCR21; GPCR12; FLJ18149; FLJ97704; MGC138349; MGC138351; |
| Gene ID | 2835 |
| mRNA Refseq | NM_005288 |
| Protein Refseq | NP_005279 |
| MIM | 600752 |
| UniProt ID | P47775 |
| ◆ Recombinant Proteins | ||
| GPR12-3843M | Recombinant Mouse GPR12 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL16088RF | Recombinant Full Length Rat G-Protein Coupled Receptor 12(Gpr12) Protein, His-Tagged | +Inquiry |
| GPR12-2303R | Recombinant Rat GPR12 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GPR12-202HF | Recombinant Full Length Human GPR12 Protein | +Inquiry |
| GPR12-2649R | Recombinant Rat GPR12 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR12 Products
Required fields are marked with *
My Review for All GPR12 Products
Required fields are marked with *
