Recombinant Full Length Human GPR12 Protein, GST-tagged

• Cat.No.: GPR12-5614HF
• Product Overview: Human GPR12 full-length ORF ( NP_005279.1, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 334 amino acids
• Description: GPR12 (G Protein-Coupled Receptor 12) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity and phosphatidylcholine binding. An important paralog of this gene is GPR6.
• Molecular Mass: 63.1 kDa
• AA Sequence: MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCTSGTLISCENAIVVLIIFHNPSLRAPMFLLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLIVASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLATSHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPR12 G protein-coupled receptor 12 [ Homo sapiens ]
• Official Symbol: GPR12
• Synonyms: GPR12; G protein-coupled receptor 12; G-protein coupled receptor 12; GPCR21; GPCR12; FLJ18149; FLJ97704; MGC138349; MGC138351
• Gene ID: 2835
• mRNA Refseq: NM_005288
• Protein Refseq: NP_005279
• MIM: 600752
• UniProt ID: P47775