"GPR135" Related Products

Recombinant Human GPR135 Protein, GST-tagged

Cat.No. : GPR135-5183H
Product Overview : Human GPR135 partial ORF ( NP_072093, 391 a.a. - 493 a.a.) recombinant protein with GST-tag at N-terminal.
Description : GPR135 (G Protein-Coupled Receptor 135) is a Protein Coding gene. Among its related pathways are GPCRs, Other. GO annotations related to this gene include G-protein coupled receptor activity. An important paralog of this gene is GPR45.
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 37.07 kDa
AA Sequence : NPNISMLLGRNREEGYRTRNVDAFLPSQGPGLQARSRSRLRNRYANRLGACNRMSSSNPASGVAGDVAMWARKNPVVLFCREGPPEPVTAVTKQPKSEAGDTS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : GPR135 G protein-coupled receptor 135 [ Homo sapiens (human) ]
Official Symbol : GPR135
Synonyms : GPR135; G protein-coupled receptor 135; HUMNPIIY20; probable G-protein coupled receptor 135
Gene ID : 64582
mRNA Refseq : NM_022571
Protein Refseq : NP_072093
MIM : 607970
UniProt ID : Q8IZ08

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.