| Cat.No. : | GPR135-5183H |
| Product Overview : | Human GPR135 partial ORF ( NP_072093, 391 a.a. - 493 a.a.) recombinant protein with GST-tag at N-terminal. |
| Description : | GPR135 (G Protein-Coupled Receptor 135) is a Protein Coding gene. Among its related pathways are GPCRs, Other. GO annotations related to this gene include G-protein coupled receptor activity. An important paralog of this gene is GPR45. |
| Source : | Wheat Germ |
| Species : | Human |
| Tag : | GST |
| Molecular Mass : | 37.07 kDa |
| AA Sequence : | NPNISMLLGRNREEGYRTRNVDAFLPSQGPGLQARSRSRLRNRYANRLGACNRMSSSNPASGVAGDVAMWARKNPVVLFCREGPPEPVTAVTKQPKSEAGDTS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Quality Control Testing : |
12.5% SDS-PAGE Stained with Coomassie Blue. |
| Gene Name : | GPR135 G protein-coupled receptor 135 [ Homo sapiens (human) ] |
| Official Symbol : | GPR135 |
| Synonyms : | GPR135; G protein-coupled receptor 135; HUMNPIIY20; probable G-protein coupled receptor 135 |
| Gene ID : | 64582 |
| mRNA Refseq : | NM_022571 |
| Protein Refseq : | NP_072093 |
| MIM : | 607970 |
| UniProt ID : | Q8IZ08 |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All GPR135 Products
Download Datasheet