Recombinant Human GPR135 Protein, GST-tagged
Cat.No. : | GPR135-5183H |
Product Overview : | Human GPR135 partial ORF ( NP_072093, 391 a.a. - 493 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GPR135 (G Protein-Coupled Receptor 135) is a Protein Coding gene. Among its related pathways are GPCRs, Other. GO annotations related to this gene include G-protein coupled receptor activity. An important paralog of this gene is GPR45. |
Molecular Mass : | 37.07 kDa |
AA Sequence : | NPNISMLLGRNREEGYRTRNVDAFLPSQGPGLQARSRSRLRNRYANRLGACNRMSSSNPASGVAGDVAMWARKNPVVLFCREGPPEPVTAVTKQPKSEAGDTS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPR135 G protein-coupled receptor 135 [ Homo sapiens (human) ] |
Official Symbol | GPR135 |
Synonyms | GPR135; G protein-coupled receptor 135; HUMNPIIY20; probable G-protein coupled receptor 135 |
Gene ID | 64582 |
mRNA Refseq | NM_022571 |
Protein Refseq | NP_072093 |
MIM | 607970 |
UniProt ID | Q8IZ08 |
◆ Recombinant Proteins | ||
GPR135-2650R | Recombinant Rat GPR135 Protein | +Inquiry |
GPR135-5183H | Recombinant Human GPR135 Protein, GST-tagged | +Inquiry |
RFL7913MF | Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 135(Gpr135) Protein, His-Tagged | +Inquiry |
RFL29517HF | Recombinant Full Length Human Probable G-Protein Coupled Receptor 135(Gpr135) Protein, His-Tagged | +Inquiry |
GPR135-2304R | Recombinant Rat GPR135 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR135 Products
Required fields are marked with *
My Review for All GPR135 Products
Required fields are marked with *