Recombinant Full Length Rat Probable G-Protein Coupled Receptor 135(Gpr135) Protein, His-Tagged
Cat.No. : | RFL5945RF |
Product Overview : | Recombinant Full Length Rat Probable G-protein coupled receptor 135(Gpr135) Protein (Q7TQN7) (1-457aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-457) |
Form : | Lyophilized powder |
AA Sequence : | MEEQARPPSRPAASATLPGSAHPGGAASTATAAALSFSSVATVTLGNQSDAGRPEAAGSR GPAPLLWHGAAVAAQALVLLLIFLLSSLGNCAVMGVIVKHRQLRTVTNAFILSLSLSDLL TALLCLPAAFLDLFAPPGDSGPWRSFCAASRFFSSCFGIVSTFSVALISLDRYCAIVRPP RDKLGRRRALQLLAGAWLAALGFSLPWELLRAPREPPTPQSFHRCLYRTSPDPAQLGAAY SVGLVVACYLLPFLLMCFCRYHICKTVRLSDVRVRPMTTYARVLRFFSEVRTATTVLIMI VFVICCWGPYCFLVLLAATRQGQTTQAPSLLNVAAVWLTWANGAINPVIYAIRNPNISMF LGRNREEGYRTRNMDVFLPSQGLGFQARSRNRLRNGCANRLGACSRMPSSNPASGSGGEV VMWARKNPVVLFFREDPPDPVMAVYKQHKSETRDSSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gpr135 |
Synonyms | Gpr135; G-protein coupled receptor 135 |
UniProt ID | Q7TQN7 |
◆ Recombinant Proteins | ||
GPR135-2304R | Recombinant Rat GPR135 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL5945RF | Recombinant Full Length Rat Probable G-Protein Coupled Receptor 135(Gpr135) Protein, His-Tagged | +Inquiry |
RFL7913MF | Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 135(Gpr135) Protein, His-Tagged | +Inquiry |
GPR135-2650R | Recombinant Rat GPR135 Protein | +Inquiry |
GPR135-5183H | Recombinant Human GPR135 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gpr135 Products
Required fields are marked with *
My Review for All Gpr135 Products
Required fields are marked with *
0
Inquiry Basket