Recombinant Human GPR141 Protein
Cat.No. : | GPR141-5185H |
Product Overview : | Human GPR141 full-length ORF (NP_861456.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | GPR141 is a member of the rhodopsin family of G protein-coupled receptors (GPRs) (Fredriksson et al., 2003 [PubMed 14623098]).[supplied by OMIM |
Form : | Liquid |
Molecular Mass : | 35.5 kDa |
AA Sequence : | MPGHNTSRNSSCDPIVTPHLISLYFIVLIGGLVGVISILFLLVKMNTRSVTTMAVINLVVVHSVFLLTVPFRLTYLIKKTWMFGLPFCKFVSAMLHIHMYLTFLFYVVILVTRYLIFFKCKDKVEFYRKLHAVAASAGMWTLVIVIVVPLVVSRYGIHEEYNEEHCFKFHKELAYTYVKIINYMIVIFVIAVAVILLVFQVFIIMLMVQKLRHSLLSHQEFWAQLKNLFFIGVILVCFLPYQFFRIYYLNVVTHSNACNSKVAFYNEIFLSVTAISCYDLLLFVFGGSHWFKQKIIGLWNCVLCR |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | GPR141 G protein-coupled receptor 141 [ Homo sapiens (human) ] |
Official Symbol | GPR141 |
Synonyms | GPR141; G protein-coupled receptor 141; PGR13; probable G-protein coupled receptor 141; G-protein coupled receptor PGR13 |
Gene ID | 353345 |
mRNA Refseq | NM_001329993 |
Protein Refseq | NP_001316922 |
MIM | 609045 |
UniProt ID | Q7Z602 |
◆ Recombinant Proteins | ||
RFL32218MF | Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 141(Gpr141) Protein, His-Tagged | +Inquiry |
GPR141-27H | Recombinant Human GPR141 protein, MYC/DDK-tagged | +Inquiry |
GPR141-3852M | Recombinant Mouse GPR141 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPR141-5633HF | Recombinant Full Length Human GPR141 Protein | +Inquiry |
GPR141-7146M | Recombinant Mouse GPR141 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR141 Products
Required fields are marked with *
My Review for All GPR141 Products
Required fields are marked with *
0
Inquiry Basket