Recombinant Human GPR141 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : GPR141-2091H
Product Overview : GPR141 MS Standard C13 and N15-labeled recombinant protein (NP_861456) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : GPR141 is a member of the rhodopsin family of G protein-coupled receptors (GPRs).
Molecular Mass : 35.3 kDa
AA Sequence : MPGHNTSRNSSCDPIVTPHLISLYFIVLIGGLVGVISILFLLVKMNTRSVTTMAVINLVVVHSVFLLTVPFRLTYLIKKTWMFGLPFCKFVSAMLHIHMYLTFLFYVVILVTRYLIFFKCKDKVEFYRKLHAVAASAGMWTLVIVIVVPLVVSRYGIHEEYNEEHCFKFHKELAYTYVKIINYMIVIFVIAVAVILLVFQVFIIMLMVQKLRHSLLSHQEFWAQLKNLFFIGVILVCFLPYQFFRIYYLNVVTHSNACNSKVAFYNEIFLSVTAISCYDLLLFVFGGSHWFKQKIIGLWNCVLCRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GPR141 G protein-coupled receptor 141 [ Homo sapiens (human) ]
Official Symbol GPR141
Synonyms GPR141; G protein-coupled receptor 141; PGR13; probable G-protein coupled receptor 141; G-protein coupled receptor PGR13
Gene ID 353345
mRNA Refseq NM_181791
Protein Refseq NP_861456
MIM 609045
UniProt ID Q7Z602

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPR141 Products

Required fields are marked with *

My Review for All GPR141 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon