Recombinant Human GPR141 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | GPR141-2091H |
| Product Overview : | GPR141 MS Standard C13 and N15-labeled recombinant protein (NP_861456) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | GPR141 is a member of the rhodopsin family of G protein-coupled receptors (GPRs). |
| Molecular Mass : | 35.3 kDa |
| AA Sequence : | MPGHNTSRNSSCDPIVTPHLISLYFIVLIGGLVGVISILFLLVKMNTRSVTTMAVINLVVVHSVFLLTVPFRLTYLIKKTWMFGLPFCKFVSAMLHIHMYLTFLFYVVILVTRYLIFFKCKDKVEFYRKLHAVAASAGMWTLVIVIVVPLVVSRYGIHEEYNEEHCFKFHKELAYTYVKIINYMIVIFVIAVAVILLVFQVFIIMLMVQKLRHSLLSHQEFWAQLKNLFFIGVILVCFLPYQFFRIYYLNVVTHSNACNSKVAFYNEIFLSVTAISCYDLLLFVFGGSHWFKQKIIGLWNCVLCRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | GPR141 G protein-coupled receptor 141 [ Homo sapiens (human) ] |
| Official Symbol | GPR141 |
| Synonyms | GPR141; G protein-coupled receptor 141; PGR13; probable G-protein coupled receptor 141; G-protein coupled receptor PGR13 |
| Gene ID | 353345 |
| mRNA Refseq | NM_181791 |
| Protein Refseq | NP_861456 |
| MIM | 609045 |
| UniProt ID | Q7Z602 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR141 Products
Required fields are marked with *
My Review for All GPR141 Products
Required fields are marked with *
