Recombinant Human GPR141 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GPR141-2091H |
Product Overview : | GPR141 MS Standard C13 and N15-labeled recombinant protein (NP_861456) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | GPR141 is a member of the rhodopsin family of G protein-coupled receptors (GPRs). |
Molecular Mass : | 35.3 kDa |
AA Sequence : | MPGHNTSRNSSCDPIVTPHLISLYFIVLIGGLVGVISILFLLVKMNTRSVTTMAVINLVVVHSVFLLTVPFRLTYLIKKTWMFGLPFCKFVSAMLHIHMYLTFLFYVVILVTRYLIFFKCKDKVEFYRKLHAVAASAGMWTLVIVIVVPLVVSRYGIHEEYNEEHCFKFHKELAYTYVKIINYMIVIFVIAVAVILLVFQVFIIMLMVQKLRHSLLSHQEFWAQLKNLFFIGVILVCFLPYQFFRIYYLNVVTHSNACNSKVAFYNEIFLSVTAISCYDLLLFVFGGSHWFKQKIIGLWNCVLCRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GPR141 G protein-coupled receptor 141 [ Homo sapiens (human) ] |
Official Symbol | GPR141 |
Synonyms | GPR141; G protein-coupled receptor 141; PGR13; probable G-protein coupled receptor 141; G-protein coupled receptor PGR13 |
Gene ID | 353345 |
mRNA Refseq | NM_181791 |
Protein Refseq | NP_861456 |
MIM | 609045 |
UniProt ID | Q7Z602 |
◆ Recombinant Proteins | ||
GPR141-27H | Recombinant Human GPR141 protein, MYC/DDK-tagged | +Inquiry |
GPR141-7146M | Recombinant Mouse GPR141 Protein | +Inquiry |
GPR141-5185H | Recombinant Human GPR141 Protein | +Inquiry |
GPR141-3852M | Recombinant Mouse GPR141 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPR141-5633HF | Recombinant Full Length Human GPR141 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR141 Products
Required fields are marked with *
My Review for All GPR141 Products
Required fields are marked with *