Recombinant Full Length Human GPR141 Protein

Cat.No. : GPR141-5633HF
Product Overview : Human GPR141 full-length ORF (NP_861456.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 617 amino acids
Description : GPR141 is a member of the rhodopsin family of G protein-coupled receptors (GPRs) (Fredriksson et al., 2003 [PubMed 14623098]).[supplied by OMIM
Form : Liquid
Molecular Mass : 35.5 kDa
AA Sequence : MPGHNTSRNSSCDPIVTPHLISLYFIVLIGGLVGVISILFLLVKMNTRSVTTMAVINLVVVHSVFLLTVPFRLTYLIKKTWMFGLPFCKFVSAMLHIHMYLTFLFYVVILVTRYLIFFKCKDKVEFYRKLHAVAASAGMWTLVIVIVVPLVVSRYGIHEEYNEEHCFKFHKELAYTYVKIINYMIVIFVIAVAVILLVFQVFIIMLMVQKLRHSLLSHQEFWAQLKNLFFIGVILVCFLPYQFFRIYYLNVVTHSNACNSKVAFYNEIFLSVTAISCYDLLLFVFGGSHWFKQKIIGLWNCVLCR
Applications : Antibody Production
Functional Study
Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name GPR141 G protein-coupled receptor 141 [ Homo sapiens (human) ]
Official Symbol GPR141
Synonyms GPR141; G protein-coupled receptor 141; PGR13; probable G-protein coupled receptor 141; G-protein coupled receptor PGR13
Gene ID 353345
mRNA Refseq NM_001329993
Protein Refseq NP_001316922
MIM 609045
UniProt ID Q7Z602

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPR141 Products

Required fields are marked with *

My Review for All GPR141 Products

Required fields are marked with *

0
cart-icon
0
compare icon