Recombinant Human GPR143 Protein
Cat.No. : | GPR143-5188H |
Product Overview : | Human GPR143 full-length ORF (NP_000264.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | Ocular albinism type 1 protein is a conserved integral membrane protein with seven transmembrane domains. It is expressed in the eye and epidermal melanocytes. [provided by RefSeq |
Form : | Liquid |
Molecular Mass : | 46.1 kDa |
AA Sequence : | MTQAGRRGPGTPEPRPRTQPMASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSPATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSAMWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPSVSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGAVIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNPAQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVGGQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | GPR143 G protein-coupled receptor 143 [ Homo sapiens ] |
Official Symbol | GPR143 |
Synonyms | GPR143; G protein-coupled receptor 143; OA1, ocular albinism 1 (Nettleship Falls); G-protein coupled receptor 143; ocular albinism 1 (Nettleship Falls); ocular albinism type 1 protein; OA1; NYS6; |
Gene ID | 4935 |
mRNA Refseq | NM_000273 |
Protein Refseq | NP_000264 |
MIM | 300808 |
UniProt ID | P51810 |
◆ Recombinant Proteins | ||
GPR143-5188H | Recombinant Human GPR143 Protein | +Inquiry |
GPR143-7148M | Recombinant Mouse GPR143 Protein | +Inquiry |
RFL35466MF | Recombinant Full Length Mouse G-Protein Coupled Receptor 143(Gpr143) Protein, His-Tagged | +Inquiry |
GPR143-5107C | Recombinant Chicken GPR143 | +Inquiry |
GPR143-5639HF | Recombinant Full Length Human GPR143 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR143-739HCL | Recombinant Human GPR143 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR143 Products
Required fields are marked with *
My Review for All GPR143 Products
Required fields are marked with *