Recombinant Human GPR143 Protein, GST-tagged
| Cat.No. : | GPR143-5189H |
| Product Overview : | Human GPR143 full-length ORF ( NP_000264.1, 1 a.a. - 424 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Ocular albinism type 1 protein is a conserved integral membrane protein with seven transmembrane domains. It is expressed in the eye and epidermal melanocytes. [provided by RefSeq |
| Molecular Mass : | 72.5 kDa |
| AA Sequence : | MTQAGRRGPGTPEPRPRTQPMASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSPATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSAMWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPSVSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGAVIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNPAQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVGGQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GPR143 G protein-coupled receptor 143 [ Homo sapiens ] |
| Official Symbol | GPR143 |
| Synonyms | GPR143; G protein-coupled receptor 143; OA1, ocular albinism 1 (Nettleship Falls); G-protein coupled receptor 143; ocular albinism 1 (Nettleship Falls); ocular albinism type 1 protein; OA1; NYS6; |
| Gene ID | 4935 |
| mRNA Refseq | NM_000273 |
| Protein Refseq | NP_000264 |
| MIM | 300808 |
| UniProt ID | P51810 |
| ◆ Recombinant Proteins | ||
| GPR143-5188H | Recombinant Human GPR143 Protein | +Inquiry |
| GPR143-5107C | Recombinant Chicken GPR143 | +Inquiry |
| GPR143-7148M | Recombinant Mouse GPR143 Protein | +Inquiry |
| GPR143-3853M | Recombinant Mouse GPR143 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GPR143-5640HF | Recombinant Full Length Human GPR143 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GPR143-739HCL | Recombinant Human GPR143 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR143 Products
Required fields are marked with *
My Review for All GPR143 Products
Required fields are marked with *



