Recombinant Human GPR161 Protein, GST-tagged

Cat.No. : GPR161-5205H
Product Overview : Human GPR161 partial ORF ( NP_722561.1, 362 a.a. - 460 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Upon ligand binding, G protein-coupled receptors, such as GPR161, activate cytoplasmic G proteins (see GNAS, MIM 139320), allowing the receptors to transduce extracellular signals across the plasma membrane into the cell. Phosphorylation of the receptor attenuates signaling (Matteson et al., 2008 [PubMed 18250320]).[supplied by OMIM
Molecular Mass : 36.63 kDa
AA Sequence : SNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPR161 G protein-coupled receptor 161 [ Homo sapiens ]
Official Symbol GPR161
Synonyms GPR161; G protein-coupled receptor 161; G-protein coupled receptor 161; RE2; G-protein coupled receptor RE2; FLJ33952;
Gene ID 23432
mRNA Refseq NM_153832
Protein Refseq NP_722561
MIM 612250
UniProt ID Q8N6U8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPR161 Products

Required fields are marked with *

My Review for All GPR161 Products

Required fields are marked with *

0
cart-icon