Recombinant Human GPR161 Protein, GST-tagged
| Cat.No. : | GPR161-5205H |
| Product Overview : | Human GPR161 partial ORF ( NP_722561.1, 362 a.a. - 460 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Upon ligand binding, G protein-coupled receptors, such as GPR161, activate cytoplasmic G proteins (see GNAS, MIM 139320), allowing the receptors to transduce extracellular signals across the plasma membrane into the cell. Phosphorylation of the receptor attenuates signaling (Matteson et al., 2008 [PubMed 18250320]).[supplied by OMIM |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | SNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GPR161 G protein-coupled receptor 161 [ Homo sapiens ] |
| Official Symbol | GPR161 |
| Synonyms | GPR161; G protein-coupled receptor 161; G-protein coupled receptor 161; RE2; G-protein coupled receptor RE2; FLJ33952; |
| Gene ID | 23432 |
| mRNA Refseq | NM_153832 |
| Protein Refseq | NP_722561 |
| MIM | 612250 |
| UniProt ID | Q8N6U8 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR161 Products
Required fields are marked with *
My Review for All GPR161 Products
Required fields are marked with *
