Recombinant Human GPR17 Protein
| Cat.No. : | GPR17-5208H |
| Product Overview : | Human GPR17 full-length ORF (AAH31653.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | GPR17 (G Protein-Coupled Receptor 17) is a Protein Coding gene. Diseases associated with GPR17 include Suppression Amblyopia. Among its related pathways are Nucleotide-like (purinergic) receptors and RET signaling. GO annotations related to this gene include G-protein coupled receptor activity and chemokine receptor activity. An important paralog of this gene is P2RY4. |
| Form : | Liquid |
| Molecular Mass : | 37.9 kDa |
| AA Sequence : | MNGLEVAPPGLITNFSLATAEQCGQETPLENMLFASFYLLDFILALVGNTLALWFFIRDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHFSGNHWPFGEIACRLTGFLFYLNMYASIYFLTCISADRFLAIVHPVKSLKLRRPLYAHLACAFLWVVVAVAMAPLLVSPQTVQTNHTVVCLQLYREKASHHALVSLAVAFTFPFITTVTCYLLIIRSLRQGLRVEKRLKTKAVRMIAIVLAIFLVCFVPYHVNRSVYVLHYRSHGASCATQRILALANRITSCLTSLNGALDPIMYFFVAEKFRHALCNLLCGKRLKGPPPSFEGKTNESSLSAKSEL |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | GPR17 G protein-coupled receptor 17 [ Homo sapiens ] |
| Official Symbol | GPR17 |
| Synonyms | GPR17; G protein-coupled receptor 17; uracil nucleotide/cysteinyl leukotriene receptor; R12; P2Y-like receptor; UDP/CysLT receptor; G-protein coupled receptor 17; DKFZp686M18273; |
| Gene ID | 2840 |
| mRNA Refseq | NM_001161415 |
| Protein Refseq | NP_001154887 |
| MIM | 603071 |
| UniProt ID | Q13304 |
| ◆ Recombinant Proteins | ||
| GPR17-1946R | Recombinant Rhesus monkey GPR17 Protein, His-tagged | +Inquiry |
| GPR17-7163M | Recombinant Mouse GPR17 Protein | +Inquiry |
| GPR17-2657R | Recombinant Rat GPR17 Protein | +Inquiry |
| GPR17-3864M | Recombinant Mouse GPR17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GPR17-5479HF | Recombinant Full Length Human GPR17 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR17 Products
Required fields are marked with *
My Review for All GPR17 Products
Required fields are marked with *
