Recombinant Human GPR17 Protein

Cat.No. : GPR17-5208H
Product Overview : Human GPR17 full-length ORF (AAH31653.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : GPR17 (G Protein-Coupled Receptor 17) is a Protein Coding gene. Diseases associated with GPR17 include Suppression Amblyopia. Among its related pathways are Nucleotide-like (purinergic) receptors and RET signaling. GO annotations related to this gene include G-protein coupled receptor activity and chemokine receptor activity. An important paralog of this gene is P2RY4.
Form : Liquid
Molecular Mass : 37.9 kDa
AA Sequence : MNGLEVAPPGLITNFSLATAEQCGQETPLENMLFASFYLLDFILALVGNTLALWFFIRDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHFSGNHWPFGEIACRLTGFLFYLNMYASIYFLTCISADRFLAIVHPVKSLKLRRPLYAHLACAFLWVVVAVAMAPLLVSPQTVQTNHTVVCLQLYREKASHHALVSLAVAFTFPFITTVTCYLLIIRSLRQGLRVEKRLKTKAVRMIAIVLAIFLVCFVPYHVNRSVYVLHYRSHGASCATQRILALANRITSCLTSLNGALDPIMYFFVAEKFRHALCNLLCGKRLKGPPPSFEGKTNESSLSAKSEL
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name GPR17 G protein-coupled receptor 17 [ Homo sapiens ]
Official Symbol GPR17
Synonyms GPR17; G protein-coupled receptor 17; uracil nucleotide/cysteinyl leukotriene receptor; R12; P2Y-like receptor; UDP/CysLT receptor; G-protein coupled receptor 17; DKFZp686M18273;
Gene ID 2840
mRNA Refseq NM_001161415
Protein Refseq NP_001154887
MIM 603071
UniProt ID Q13304

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPR17 Products

Required fields are marked with *

My Review for All GPR17 Products

Required fields are marked with *

0
cart-icon