Recombinant Human GPR32 Protein, GST-tagged
Cat.No. : | GPR32-5233H |
Product Overview : | Human GPR32 full-length ORF (AAH67454.1, 1 a.a. - 356 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is intronless and encodes a member of the G-protein coupled receptor 1 family. The encoded protein binds to resolvin D1 and lipoxin A4 and has been linked to pulmonary inflammation. A related pseudogene has been identified on chromosome 19. [provided by RefSeq, Nov 2012] |
Molecular Mass : | 65.56 kDa |
AA Sequence : | MNGVSEGTRGCSDRQPGVLTRDRSCSRKMNSSGCLSEEVGSLRPLTVVILSASIVVGVLGNGLVLWMTVFRMARTVSTVCFFHLALADFMLSLSLPIAMYYIVSRQWLLGEWACKLYITFVFLSYFASNCLLVFISVDRCISVLYPVWALNHRTVQRASWLAFGVWLLAAALCSAHLKFRTTRKWNGCTHCYLAFNSDNETAQIWIEGVVEGHIIGTIGHFLLGFLGPLAIIGTCAHLIRAKLLREGWVHANRPKRLLLVLVSAFFIFWSPFNVVLLVHLWRRVMLKEIYHPRMLLILQASFALGCVNSSLNPFLYVFVGRDFQEKFFQSLTSALARAFGEEEFLSSCPRGNAPRE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPR32 G protein-coupled receptor 32 [ Homo sapiens ] |
Official Symbol | GPR32 |
Synonyms | GPR32; G protein-coupled receptor 32; probable G-protein coupled receptor 32; |
Gene ID | 2854 |
mRNA Refseq | NM_001506 |
Protein Refseq | NP_001497 |
MIM | 603195 |
UniProt ID | O75388 |
◆ Recombinant Proteins | ||
RFL681HF | Recombinant Full Length Human Probable G-Protein Coupled Receptor 32(Gpr32) Protein, His-Tagged | +Inquiry |
GPR32-5233H | Recombinant Human GPR32 Protein, GST-tagged | +Inquiry |
GPR32-5537HF | Recombinant Full Length Human GPR32 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR32-5787HCL | Recombinant Human GPR32 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR32 Products
Required fields are marked with *
My Review for All GPR32 Products
Required fields are marked with *
0
Inquiry Basket