Recombinant Human GPR35 protein, His-GST-tagged

• Cat.No.: GPR35-15H
• Product Overview: Recombinant Human GPR35 protein(NP_001182310.1)(Arg240~Ala309), fused to two tags, His and GST tag at the N-terminal, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His
• Protein Length: Arg240~Ala309
• Form: 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
• Molecular Mass: 41kDa(Analysis of differences refer to the manual)
• AA Sequence: RLAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTLA
• Endotoxin: <1.0EU per 1µg (determined by the LAL method)
• Purity: > 95%
• Applications: Positive Control; Immunogen; SDS-PAGE; WB.
  If bio-activity of the protein is needed, please check active protein.
• Notes: The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures.
• Stability: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
• Storage: Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
• Reconstitution: Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.

Gene Information

• Gene Name: GPR35 G protein-coupled receptor 35 [ Homo sapiens (human) ]
• Official Symbol: GPR35
• Synonyms: KYNA receptor; Kynurenic acid receptor
• Gene ID: 2859
• mRNA Refseq: NM_001195381.2
• Protein Refseq: NP_001182310.1
• MIM: 602646
• UniProt ID: Q9HC97