Recombinant Human GPR35 protein, His-GST-tagged
Cat.No. : | GPR35-15H |
Product Overview : | Recombinant Human GPR35 protein(NP_001182310.1)(Arg240~Ala309), fused to two tags, His and GST tag at the N-terminal, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | Arg240~Ala309 |
Form : | 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300. |
Molecular Mass : | 41kDa(Analysis of differences refer to the manual) |
AA Sequence : | RLAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTLA |
Endotoxin : | <1.0EU per 1µg (determined by the LAL method) |
Purity : | > 95% |
Applications : | Positive Control; Immunogen; SDS-PAGE; WB. If bio-activity of the protein is needed, please check active protein. |
Notes : | The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures. |
Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months. |
Reconstitution : | Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
Gene Name | GPR35 G protein-coupled receptor 35 [ Homo sapiens (human) ] |
Official Symbol | GPR35 |
Synonyms | KYNA receptor; Kynurenic acid receptor |
Gene ID | 2859 |
mRNA Refseq | NM_001195381.2 |
Protein Refseq | NP_001182310.1 |
MIM | 602646 |
UniProt ID | Q9HC97 |
◆ Recombinant Proteins | ||
RFL28295HF | Recombinant Full Length Human G-Protein Coupled Receptor 35(Gpr35) Protein, His-Tagged | +Inquiry |
GPR35-15H | Recombinant Human GPR35 protein, His-GST-tagged | +Inquiry |
GPR35-1484H | Recombinant Human GPR35 Full Length Transmembrane protein, His-tagged | +Inquiry |
GPR35-2890H | Recombinant Human GPR35 Protein (Arg240-Ala309), N-GST tagged | +Inquiry |
GPR35-3066H | Recombinant Human GPR35 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR35 Products
Required fields are marked with *
My Review for All GPR35 Products
Required fields are marked with *