Recombinant Human GPR35 protein, His-GST-tagged

Cat.No. : GPR35-15H
Product Overview : Recombinant Human GPR35 protein(NP_001182310.1)(Arg240~Ala309), fused to two tags, His and GST tag at the N-terminal, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : Arg240~Ala309
Form : 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
Molecular Mass : 41kDa(Analysis of differences refer to the manual)
AA Sequence : RLAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTLA
Endotoxin : <1.0EU per 1µg (determined by the LAL method)
Purity : > 95%
Applications : Positive Control; Immunogen; SDS-PAGE; WB.
If bio-activity of the protein is needed, please check active protein.
Notes : The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures.
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
Reconstitution : Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Gene Name GPR35 G protein-coupled receptor 35 [ Homo sapiens (human) ]
Official Symbol GPR35
Synonyms KYNA receptor; Kynurenic acid receptor
Gene ID 2859
mRNA Refseq NM_001195381.2
Protein Refseq NP_001182310.1
MIM 602646
UniProt ID Q9HC97

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPR35 Products

Required fields are marked with *

My Review for All GPR35 Products

Required fields are marked with *

0
cart-icon
0
compare icon