Recombinant Human GPR89B Protein, GST-tagged
| Cat.No. : | GPR89B-5276H |
| Product Overview : | Human GPR89 partial ORF ( AAH03187, 175 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | GPR89B (G Protein-Coupled Receptor 89B) is a Protein Coding gene. GO annotations related to this gene include signal transducer activity and voltage-gated anion channel activity. An important paralog of this gene is GPR89A. |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | SYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDALEELSRQLFLETADLYATKERIEYSKTFKGK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GPR89B G protein-coupled receptor 89B [ Homo sapiens ] |
| Official Symbol | GPR89B |
| Synonyms | GPR89B; G protein-coupled receptor 89B; UNQ192; |
| Gene ID | 51463 |
| mRNA Refseq | NM_001350180 |
| Protein Refseq | NP_001337109 |
| MIM | 612806 |
| UniProt ID | P0CG08 |
| ◆ Recombinant Proteins | ||
| GPR89B-1961R | Recombinant Rhesus monkey GPR89B Protein, His-tagged | +Inquiry |
| GPR89B-5276H | Recombinant Human GPR89B Protein, GST-tagged | +Inquiry |
| GPR89B-2490C | Recombinant Chicken GPR89B | +Inquiry |
| GPR89B-5523HF | Recombinant Full Length Human GPR89B Protein | +Inquiry |
| GPR89B-1782R | Recombinant Rhesus Macaque GPR89B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GPR89B-5773HCL | Recombinant Human GPR89B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR89B Products
Required fields are marked with *
My Review for All GPR89B Products
Required fields are marked with *



