Recombinant Human GPR89B Protein, GST-tagged

Cat.No. : GPR89B-5276H
Product Overview : Human GPR89 partial ORF ( AAH03187, 175 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GPR89B (G Protein-Coupled Receptor 89B) is a Protein Coding gene. GO annotations related to this gene include signal transducer activity and voltage-gated anion channel activity. An important paralog of this gene is GPR89A.
Molecular Mass : 37.84 kDa
AA Sequence : SYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDALEELSRQLFLETADLYATKERIEYSKTFKGK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPR89B G protein-coupled receptor 89B [ Homo sapiens ]
Official Symbol GPR89B
Synonyms GPR89B; G protein-coupled receptor 89B; UNQ192;
Gene ID 51463
mRNA Refseq NM_001350180
Protein Refseq NP_001337109
MIM 612806
UniProt ID P0CG08

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPR89B Products

Required fields are marked with *

My Review for All GPR89B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon