Recombinant Human GPRC5A Protein

• Cat.No.: GPRC5A-5283H
• Product Overview: Human GPRC5A full-length ORF (NP_003970.1) recombinant protein without tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation. [provided by RefSeq
• Form: Liquid
• Molecular Mass: 40.3 kDa
• AA Sequence: MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFLFLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: GPRC5A G protein-coupled receptor, family C, group 5, member A [ Homo sapiens ]
• Official Symbol: GPRC5A
• Synonyms: GPRC5A; G protein-coupled receptor, family C, group 5, member A; GPCR5A, RAI3, retinoic acid induced 3; retinoic acid-induced protein 3; RAIG1; RAIG-1; retinoic acid induced 3; retinoic acid responsive; retinoic acid-induced gene 1 protein; orphan G-protein-coupling receptor PEIG-1; G-protein coupled receptor family C group 5 member A; RAI3; GPCR5A
• Gene ID: 9052
• mRNA Refseq: NM_003979
• Protein Refseq: NP_003970
• MIM: 604138
• UniProt ID: Q8NFJ5