Recombinant Human GPRC5C Protein, GST-tagged

Cat.No. : GPRC5C-5289H
Product Overview : Human GPRC5C partial ORF ( NP_071319, 387 a.a. - 486 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The specific function of this protein is unknown; however, this protein may mediate the cellular effects of retinoic acid on the G protein signal transduction cascade. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : AFSMDEPVAAKRPVSPYSGYNGQLLTSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQVFRNPYVWD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPRC5C G protein-coupled receptor, family C, group 5, member C [ Homo sapiens ]
Official Symbol GPRC5C
Synonyms GPRC5C; G protein-coupled receptor, family C, group 5, member C; G-protein coupled receptor family C group 5 member C; RAIG 3; orphan G-protein coupled receptor; retinoic acid-induced gene 3 protein; retinoic acid responsive gene protein; RAIG3; RAIG-3; MGC131820;
Gene ID 55890
mRNA Refseq NM_018653
Protein Refseq NP_061123
MIM 605949
UniProt ID Q9NQ84

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPRC5C Products

Required fields are marked with *

My Review for All GPRC5C Products

Required fields are marked with *

0
cart-icon
0
compare icon