Recombinant Human GPRC5C Protein, GST-tagged
| Cat.No. : | GPRC5C-5289H |
| Product Overview : | Human GPRC5C partial ORF ( NP_071319, 387 a.a. - 486 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The specific function of this protein is unknown; however, this protein may mediate the cellular effects of retinoic acid on the G protein signal transduction cascade. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | AFSMDEPVAAKRPVSPYSGYNGQLLTSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQVFRNPYVWD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GPRC5C G protein-coupled receptor, family C, group 5, member C [ Homo sapiens ] |
| Official Symbol | GPRC5C |
| Synonyms | GPRC5C; G protein-coupled receptor, family C, group 5, member C; G-protein coupled receptor family C group 5 member C; RAIG 3; orphan G-protein coupled receptor; retinoic acid-induced gene 3 protein; retinoic acid responsive gene protein; RAIG3; RAIG-3; MGC131820; |
| Gene ID | 55890 |
| mRNA Refseq | NM_018653 |
| Protein Refseq | NP_061123 |
| MIM | 605949 |
| UniProt ID | Q9NQ84 |
| ◆ Recombinant Proteins | ||
| GPRC5C-5288H | Recombinant Human GPRC5C Protein | +Inquiry |
| GPRC5C-6055Z | Recombinant Zebrafish GPRC5C | +Inquiry |
| GPRC5C-5547HF | Recombinant Full Length Human GPRC5C Protein | +Inquiry |
| RFL31550RF | Recombinant Full Length Rat G-Protein Coupled Receptor Family C Group 5 Member C(Gprc5C) Protein, His-Tagged | +Inquiry |
| RFL18790BF | Recombinant Full Length Bovine G-Protein Coupled Receptor Family C Group 5 Member C(Gprc5C) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GPRC5C-748HCL | Recombinant Human GPRC5C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPRC5C Products
Required fields are marked with *
My Review for All GPRC5C Products
Required fields are marked with *
