Recombinant Human GPRC5D Protein, GST-tagged
| Cat.No. : | GPRC5D-5291H |
| Product Overview : | Human GPRC5D partial ORF ( NP_061124, 261 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a member of the G protein-coupled receptor family; however, the specific function of this gene has not yet been determined. [provided by RefSeq |
| Molecular Mass : | 35.09 kDa |
| AA Sequence : | ELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GPRC5D G protein-coupled receptor, family C, group 5, member D [ Homo sapiens ] |
| Official Symbol | GPRC5D |
| Synonyms | GPRC5D; G protein-coupled receptor, family C, group 5, member D; G-protein coupled receptor family C group 5 member D; orphan G-protein coupled receptor; MGC129713; MGC129714; |
| Gene ID | 55507 |
| mRNA Refseq | NM_018654 |
| Protein Refseq | NP_061124 |
| MIM | 607437 |
| UniProt ID | Q9NZD1 |
| ◆ Cell & Tissue Lysates | ||
| GPRC5D-749HCL | Recombinant Human GPRC5D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPRC5D Products
Required fields are marked with *
My Review for All GPRC5D Products
Required fields are marked with *



