Recombinant Human GPRC5D Protein, GST-tagged

Cat.No. : GPRC5D-5291H
Product Overview : Human GPRC5D partial ORF ( NP_061124, 261 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the G protein-coupled receptor family; however, the specific function of this gene has not yet been determined. [provided by RefSeq
Molecular Mass : 35.09 kDa
AA Sequence : ELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPRC5D G protein-coupled receptor, family C, group 5, member D [ Homo sapiens ]
Official Symbol GPRC5D
Synonyms GPRC5D; G protein-coupled receptor, family C, group 5, member D; G-protein coupled receptor family C group 5 member D; orphan G-protein coupled receptor; MGC129713; MGC129714;
Gene ID 55507
mRNA Refseq NM_018654
Protein Refseq NP_061124
MIM 607437
UniProt ID Q9NZD1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPRC5D Products

Required fields are marked with *

My Review for All GPRC5D Products

Required fields are marked with *

0
cart-icon
0
compare icon