Recombinant Human GPRC5D Protein, GST-tagged

Cat.No. : GPRC5D-501H
Product Overview : Recombinant Human GPRC5D Protien(NP_061124)(256-345 aa), fused to GST tag, was expressed in E. coli.
Availability September 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 256-345 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : LYIVPELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name GPRC5D G protein-coupled receptor, family C, group 5, member D [ Homo sapiens ]
Official Symbol GPRC5D
Synonyms GPRC5D; G protein-coupled receptor, family C, group 5, member D; G-protein coupled receptor family C group 5 member D; orphan G-protein coupled receptor; MGC129713; MGC129714;
Gene ID 55507
mRNA Refseq NM_018654.1
Protein Refseq NP_061124
MIM 607437
UniProt ID Q9NZD1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPRC5D Products

Required fields are marked with *

My Review for All GPRC5D Products

Required fields are marked with *

0
cart-icon