Recombinant Human GPS1 protein(91-170 aa), C-His-tagged

Cat.No. : GPS1-2843H
Product Overview : Recombinant Human GPS1 protein(Q13098)(91-170 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 91-170 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : YEEIHRKLSEATRSSLRELQNAPDAIPESGVEPPALDTAWVEATRKKALLKLEKLDTDLKNYKGNSIKESIRRGHDDLGD
Gene Name GPS1 G protein pathway suppressor 1 [ Homo sapiens ]
Official Symbol GPS1
Synonyms GPS1; G protein pathway suppressor 1; COP9 signalosome complex subunit 1; COPS1; CSN1; SGN1; GPS-1; signalosome subunit 1; JAB1-containing signalosome subunit 1; MGC71287;
Gene ID 2873
mRNA Refseq NM_004127
Protein Refseq NP_004118
MIM 601934
UniProt ID Q13098

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPS1 Products

Required fields are marked with *

My Review for All GPS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon