Recombinant Human GPX5 protein, His-GST-tagged

Cat.No. : GPX5-4280H
Product Overview : Recombinant Human GPX5 protein(O75715)(1-100aa), fused to N-terminal His tag and GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 1-100aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 42.9 kDa
AA Sequence : MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name GPX5 glutathione peroxidase 5 (epididymal androgen-related protein) [ Homo sapiens ]
Official Symbol GPX5
Synonyms GPX5; glutathione peroxidase 5 (epididymal androgen-related protein); epididymal secretory glutathione peroxidase; EGLP; GPx-5; GSHPx-5; epididymal androgen-related protein; epididymis-specific glutathione peroxidase-like protein;
Gene ID 2880
mRNA Refseq NM_001509
Protein Refseq NP_001500
MIM 603435
UniProt ID O75715

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPX5 Products

Required fields are marked with *

My Review for All GPX5 Products

Required fields are marked with *

0
cart-icon
0
compare icon