Recombinant Human GPX5 protein, His-GST-tagged
Cat.No. : | GPX5-4280H |
Product Overview : | Recombinant Human GPX5 protein(O75715)(1-100aa), fused to N-terminal His tag and GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 1-100aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.9 kDa |
AA Sequence : | MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | GPX5 glutathione peroxidase 5 (epididymal androgen-related protein) [ Homo sapiens ] |
Official Symbol | GPX5 |
Synonyms | GPX5; glutathione peroxidase 5 (epididymal androgen-related protein); epididymal secretory glutathione peroxidase; EGLP; GPx-5; GSHPx-5; epididymal androgen-related protein; epididymis-specific glutathione peroxidase-like protein; |
Gene ID | 2880 |
mRNA Refseq | NM_001509 |
Protein Refseq | NP_001500 |
MIM | 603435 |
UniProt ID | O75715 |
◆ Recombinant Proteins | ||
GPX5-2680R | Recombinant Rat GPX5 Protein | +Inquiry |
Gpx5-1107R | Recombinant Rat Gpx5 protein, His-tagged | +Inquiry |
GPX5-4280H | Recombinant Human GPX5 protein, His-GST-tagged | +Inquiry |
GPX5-7233M | Recombinant Mouse GPX5 Protein | +Inquiry |
GPX5-2142H | Recombinant Human GPX5 Protein (1-100 aa), His-Trx-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPX5 Products
Required fields are marked with *
My Review for All GPX5 Products
Required fields are marked with *
0
Inquiry Basket